KEGG   Trypanosoma brucei: Tb10.6k15.2220Help
Entry
Tb10.6k15.2220    CDS       T01013                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit 8, putative
  KO
K03252  translation initiation factor 3 subunit C
Organism
tbr  Trypanosoma brucei
Pathway
tbr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:tbr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    Tb10.6k15.2220
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:tbr03012]
    Tb10.6k15.2220
Translation factors [BR:tbr03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    Tb10.6k15.2220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI M11L
Motif
Other DBs
NCBI-GeneID: 3662211
NCBI-ProteinID: XP_823063
UniProt: Q38AD5
LinkDB All DBs
Position
10
AA seq 740 aa AA seqDB search
MADFFNVSDSDESIDEVIQRDDQVERNTAQIDPKWFEITDDEAAEEQRVVLSRREKSLNE
IQTNADVFDFNVDQGTWVGAEQSFKELREKSDIHKRRFQSTPFPFLECLRNTPDLKTHLS
ERESFAKPEEFRSLKGLIKAVEEAMETYKDDIERLYDEEDGDEGDEEEAEKELTEDDIVK
QLRESVTCTGKKASKYRKLANECKRKGYKALQITTCGIVADALLEEDNREVYVSTKTWAK
SCDTLEECFGLIVENPGIRLSDKFSDKLNKRDAFIKGGLHALLQSLSKHLRRITQFKDGI
PSDYIEIVHLENRLVAIADALFGYYRDNSRGRAVCCQILVDILGSRRQEAHEILFGKMPP
GQREAVSDSVIETVRSLYEQLLLIGDDESKSLALLHLVYQMGLEGKYREGRDLIRRSGGA
EKLCNSNHNSVLYNRAVAQLGLASFIMGDIMQAYELLSPLWNSWEGPEVLIGQKLPNLKD
EKGDEELRYRDLLLPPHAHIPYSQLELATMLSTLVVGTVDEAKKPYEVTHHHRYFYRVIN
QMQFQPLLGEPIEFREQITAAYTALKLGDYARSSEVIKNMKVWDNMPRGTEARDTFLQRL
KEAALQIFCYNSRRSFATISVEIMAKKFDITESTVKHVINGIISENNTPLIAVWDRDDQY
LHVDRSNISRLQYLVEATARSVENIAHYCEKGGHGNDFRGGRGQGYMRGGRGFGRGGGSD
FRGAADYGRGRGRGRARGGQ
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttctttaacgtaagtgacagtgacgaaagtatcgacgaagttatccagcgc
gacgatcaggtagaaaggaacaccgcccagatcgatccaaaatggttcgaaataaccgat
gatgaagctgcagaggaacagcgtgtcgtcctttctcggcgtgagaagtcattgaacgaa
atacagacaaacgccgatgtttttgacttcaacgttgatcaggggacatgggtcggagcg
gagcaatcattcaaagagcttcgcgagaaatcggatatccacaagcggagatttcagtcg
acacctttcccattcctggagtgcctccgaaacactccagatctcaagacacacctatcc
gagagagaatcatttgcaaagccagaggagtttcgttccctcaaggggctgatcaaggct
gttgaagaagcgatggagacgtacaaggacgatattgaacgtttgtacgacgaagaagat
ggtgatgaaggtgacgaggaggaggcggaaaaggaattaactgaagacgacattgtaaag
caactgcgggagtccgtgacgtgtaccggtaagaaagcgtccaaataccgtaagcttgct
aacgaatgcaaaaggaaagggtataaggcactgcagatcacgacatgtggtatcgttgcg
gatgcccttctcgaagaggataatcgcgaggtctacgtcagtaccaaaacgtgggcaaaa
tcctgtgatacgttggaggaatgcttcggtctgatagttgaaaatcccggaataaggcta
tcggacaaattttccgacaagctcaacaaaagggatgcattcattaagggtgggttgcat
gctctgttgcagagtctcagcaaacacctgcgacgcattacgcaatttaaagacggtatt
ccatccgactatatcgagattgttcacttggagaaccggctggtggctattgctgacgct
ctcttcggctattatagggataacagccgcggcagagcggtttgttgccagattcttgtt
gacatccttgggtcaaggagacaggaggcccacgagattttgtttggcaagatgcctccg
ggacagcgtgaggccgtcagtgacagtgttattgagacagtgcgatcgctctacgagcaa
ctcctcctcatcggtgatgacgagtccaaatcacttgctctgcttcatttggtttaccaa
atgggactagaagggaagtaccgggagggacgggatctcatacgacgctctggtggggca
gagaagctgtgcaactccaaccataattctgtcctctataacagagctgtcgcacaactg
ggtttggcatccttcattatgggtgacatcatgcaagcgtatgagctcctgagtccttta
tggaattcgtgggaaggtcctgaggtattgataggccaaaagctgccgaatttaaaagat
gagaagggggatgaggagttgaggtaccgtgatttactactgcctccacacgcccacatc
ccttatagtcagctggagcttgcaacgatgctttcaacgcttgtagtcggcacagtggac
gaagcaaaaaagccctacgaggttacacaccatcaccgctatttctaccgtgtaataaat
cagatgcagtttcagccactcctgggcgagcctatcgagttcagagagcaaataacagct
gcttacactgccttgaagctgggtgattatgcgcgctcaagtgaagttatcaaaaacatg
aaggtctgggataacatgccgagaggtactgaggcacgagacacatttctacaacgtttg
aaggaagcagccctacagatattctgttacaacagcaggcgtagctttgcgacgatatcc
gtggagattatggccaagaagtttgatataactgagagcacagttaagcatgtcattaac
ggtattatatcagaaaataacacccccctcattgctgtgtgggacagagatgatcagtac
cttcacgtggatagaagcaacatttcacgcctgcagtacctggtggaggctactgcgaga
agtgtggaaaatattgcccactactgcgagaagggcgggcatggcaacgatttccgtgga
ggacggggccaggggtatatgcgtgggggacgaggttttggacgcggaggtggcagcgac
ttccgtggcgcagcagactacgggcgcggccgggggcgtggtcgtgctaggggagggcag
taa

DBGET integrated database retrieval system