KEGG   Trypanosoma brucei: Tb927.2.3080Help
Entry
Tb927.2.3080      CDS       T01013                                 

Definition
(RefSeq) fatty acid desaturase, putative
  KO
K10256  omega-6 fatty acid desaturase / acyl-lipid omega-6 desaturase (Delta-12 desaturase) [EC:1.14.19.6 1.14.19.22]
Organism
tbr  Trypanosoma brucei
Pathway
tbr01040  Biosynthesis of unsaturated fatty acids
tbr01100  Metabolic pathways
tbr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tbr00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Tb927.2.3080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tbr01004]
    Tb927.2.3080
Enzymes [BR:tbr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.6  acyl-CoA (9+3)-desaturase
     Tb927.2.3080
    1.14.19.22  acyl-lipid omega-6 desaturase (cytochrome b5)
     Tb927.2.3080
Lipid biosynthesis proteins [BR:tbr01004]
 Desaturase
  Omega
   Tb927.2.3080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase DUF3474 DUSP
Motif
Other DBs
NCBI-GeneID: 3655608
NCBI-ProteinID: XP_951577
UniProt: Q587G0
LinkDB All DBs
Position
2
AA seq 408 aa AA seqDB search
MLPKQQMGGSVCNASIETVNTEATDPSEAKKIVLNAGRSEKVNVYVPPSTLMVRDIQEQI
PAEYFQRSMWRSFSYLSRDMFQLFLTFVIMYNFVLPMLDSSLLNAVPPVAWLSRAAAWMI
YWFIQGLNGTALWVLAHECGHQAFCNSRRVNNAVGMILHSALLVPYHSWRLTHGTHHKHT
NHLTKDLVFVPVQRSAVGEAVEEAPIVMLWNMALMFLFGWPMHLLVNVGGQKFDRFTSHF
DPNAPFFRRADYNNVMVSNMGVLLTLSILGACSWSFGFAVVVRWYLIPYLWVNFWLVYIT
YMQHSDVRLPHYTHDHWTYVRGAVAAVDRDFGPLLNSWLHHINDSHVVHHLFSQMPHYNA
IEVTRKHIRDILGDLYVTDAKPLLKSLVHTWRECRYVVPSEGICIYRS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgttgcctaagcaacagatgggaggttctgtttgcaacgcttccatagaaactgtcaac
acggaggccacagatccaagtgaggctaaaaagattgtactcaatgcaggacgaagtgaa
aaggtgaacgtttatgttccaccttccacgctcatggtgcgggatattcaggagcaaatt
cctgctgaatatttccagcgtagcatgtggaggagctttagctaccttagccgtgacatg
tttcagcttttcctcacattcgtcatcatgtacaattttgtgcttcccatgctggacagt
tcccttctgaatgccgttccacccgtggcttggctctcgcgagctgcggcatggatgata
tattggtttatacaagggcttaatggtacggctctatgggttcttgcacatgaatgtggt
catcaggcattttgcaattcccgtagggtaaacaacgccgtggggatgattcttcacagc
gctttgcttgttccgtatcacagctggcgtcttactcatggcactcaccataaacacacc
aatcatctcacgaaggacctcgttttcgtacctgtgcagcgctcagccgtgggagaggcg
gtggaggaggcgcccattgttatgttgtggaatatggcactaatgttcctctttggttgg
cccatgcatttgcttgtcaacgtgggtggtcagaagtttgatcgcttcacttcccatttt
gaccccaacgcaccgttctttcgtcgcgcagactataataatgttatggtgtcgaatatg
ggagtgctgcttacattgtctatacttggtgcatgcagttggagtttcggttttgccgtg
gtggtgcgctggtacctcattccgtacctttgggtaaatttctggcttgtgtacattacg
tacatgcagcattcggatgtaaggttgccgcactatacgcatgatcattggacatatgtg
cgaggcgctgtcgctgcggtagacagagattttggtccgttactgaacagctggttacat
cacattaatgattcacatgtggtgcatcatctcttcagtcagatgccacattataatgcc
attgaggtaacgaggaaacatattcgagatattcttggggatttgtacgtgacggatgcg
aagccgttgctgaagtccctggtgcatacatggcgtgagtgccgttatgtcgtcccttcg
gaggggatctgcatttatcgcagttaa

DBGET integrated database retrieval system