KEGG   Trypanosoma brucei brucei: Tb927.2.6000
Entry
Tb927.2.6000      CDS       T01013                                 

Definition
(RefSeq) glycosylphosphatidylinositol-specific phospholipase C
  KO
K06038  glycosylphosphatidylinositol diacylglycerol-lyase [EC:4.6.1.14]
Organism
tbr  Trypanosoma brucei brucei
Brite
KEGG Orthology (KO) [BR:tbr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tb927.2.6000
Enzymes [BR:tbr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.14  glycosylphosphatidylinositol diacylglycerol-lyase
     Tb927.2.6000
SSDB
Motif
Pfam: PI-PLC-X
Other DBs
NCBI-GeneID: 3655901
NCBI-ProteinID: XP_951739
UniProt: Q586B7
LinkDB
Position
2
AA seq 358 aa
MFGGVKWSPQSWMSDTRSSIEKKCIGQVYMVGAHNAGTHGIQMFSPFGLDAPEKLRSLPP
YVTFLLRFLTVGVSSRWGRCQNLSIRQLLDHGVRYLDLRMNISPDQENKIYTTHFHISVP
LQEVLKDVKDFLTTPASANEFVILDFLHFYGFNESHTMKRFVEELQALEEFYIPTTVSLT
TPLCNLWQSTRRIFLVVRPYVEYPYARLRSVALKSIWVNQMELNDLLDRLEELMTRDLED
VSIGGVPSKMYVTQAIGTPRNNDFAVAACCGACPGSHPDLYSAAKHKNPHLLQWFYDLNV
NGVMRGERVTIRRGNNTHGNILLLDFVQEGTCTVKGVDKPMNAVALCVHLNTNQTARS
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtttggtggtgtaaagtggtcaccgcagtcatggatgagtgacacgcggtcttccatt
gagaagaaatgtattggtcaagtatatatggtaggagcacataatgcaggaacacacggc
atacaaatgttttccccgtttggattagatgcccctgaaaagttacgaagcctccctcca
tatgtgacctttcttttaagatttcttactgttggtgtgagcagcagatggggacgttgt
caaaatctttctattcgacagcttttggatcatggggtgcgttatctcgacttacgcatg
aacataagtccggatcaggaaaataaaatttacacaacgcatttccatatttctgttcca
ctacaagaggttctgaaggatgtcaaggatttcttgaccacacctgcaagcgccaacgaa
tttgtcatcctcgatttcttgcatttctacggatttaatgagagccatacgatgaagcgc
tttgttgaggagctgcaagcacttgaggagttttacattcccacaaccgtctctttaacc
acaccactttgtaacctctggcagtcaaccagacgtatttttcttgttgtgagaccttat
gtagaatacccttatgcacgactccgcagtgttgcgcttaaatccatttgggttaatcaa
atggagttgaatgatcttctcgaccggttggaggaactcatgacgcgtgatttggaagat
gtcagtattggcggggttccatctaaaatgtacgtcacgcaagctatcggtacgccgcga
aataacgactttgcggtggcagcgtgttgtggcgcgtgtcccggttcacatcccgatttg
tattccgctgcaaagcataaaaatccacatcttttgcagtggttttatgatttaaatgtt
aatggtgttatgcgaggggagcgtgtgactataagacggggaaacaatacacatggaaat
atacttttgcttgatttcgtgcaagaaggcacttgtaccgttaagggagtcgacaaaccg
atgaatgccgttgcgttatgcgttcatttaaacaccaaccaaaccgcaaggtcataa

DBGET integrated database retrieval system