KEGG   Trypanosoma brucei: Tb927.8.6580Help
Entry
Tb927.8.6580      CDS       T01013                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein, putative
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tbr  Trypanosoma brucei
Pathway
tbr00020  Citrate cycle (TCA cycle)
tbr00190  Oxidative phosphorylation
tbr01100  Metabolic pathways
tbr01110  Biosynthesis of secondary metabolites
tbr01130  Biosynthesis of antibiotics
tbr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tb927.8.6580
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Tb927.8.6580
Enzymes [BR:tbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Tb927.8.6580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 3659666
NCBI-ProteinID: XP_847488
UniProt: Q57TV5
LinkDB All DBs
Position
8
AA seq 609 aa AA seqDB search
MLRRSFNRLASHLSKAYPVIDHTFDCVVVGAGGSGLRAAMGVAASGYNVACVSKLYPSRS
HTIAAQGGINAALGNCEEDDWRWHVYDTVKGSDWLGDQDAIQYMCQEAPCVVSELESMGL
PFLRTKDGFIYQRAFGGQSIHYGGKQARRTCAASDRTGHAMLHTLYGQSFQYGVNFFNEY
YCLDLMVEDGCCRGIVAMSIDDGTIHRFRSKYTILATGGYGRCWFTTTSAKSCTGDGTAM
VARAGLAAEDMEFVQFHPTGIYGPGVLITEGSRGEGGYLINSEGERFMERYAPKAKDLAS
RDVVSRAITLELLAGRGCGPKKDHVLLQLHHLPPEQLRQKLPGISESAHIFAGVDVTKES
IPIVPTVHYSMGGVPTLWTGEVVNPRNGDDDAIVPGLLAAGECACASVHGANRLGANSLL
DIVVFGKSCANTVIFNLTKEGRAQPELRSDAGESSIADLDKILHNKGDIPVARIRERMKE
TMALYAAVFRTEESMLKGQAIIEECYRDYSHVFVHDKSPVWNSNLIEALELRNLLYNALM
TIASAAARRESRGAHARDDYPERDDHNWMKHTLAYINDKEGKAKLAYRRVHSEMLTSELD
SIPPAKRVY
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgctacggcgttcttttaaccgtctcgcctcacacctcagcaaggcgtaccccgtgatc
gatcatacgtttgactgcgtggtagtcggtgcagggggctctgggcttcgtgccgcaatg
ggtgttgccgcctcgggttataatgtggcatgcgtctccaagttatatccctcccgttcc
cacacaattgcggctcagggaggtatcaacgctgctctcggaaattgcgaggaggatgac
tggcgttggcatgtgtatgatacagtgaagggaagtgattggttaggtgaccaggatgca
attcagtacatgtgtcaggaagcaccttgcgtggtgtcggaattggagagcatgggtctt
ccatttctccgtacaaaggatggcttcatctaccagcgagcattcggtggacagtctatt
cactatggtgggaagcaggcaaggcggacatgtgcggcatccgatcgcacggggcatgcg
atgttgcacacactgtatggccagtccttccagtacggagtgaatttctttaacgaatat
tattgtctggacttgatggtggaggacggctgttgtcgtggcattgttgcgatgagcata
gacgatggtactatccaccgtttccgctcaaagtataccatccttgcaacgggtgggtat
ggtcggtgctggttcacaaccaccagtgctaagtcatgcacgggtgatggaacagcgatg
gtggctcgtgccggtttggccgcagaggatatggagtttgtgcagttccatccgacgggt
atttatggaccaggagttttaattactgaggggtcacgaggtgagggaggttaccttatt
aacagcgagggggagcgtttcatggagcggtatgctccgaaagcgaaggatctggcatct
cgcgatgtggtgtcgcgtgccatcactctcgaactgctcgccggtcgtggttgtgggcca
aagaaggatcatgttcttcttcagttacatcacctcccaccagagcagcttcgccaaaag
cttccgggtatctctgagagcgctcacatatttgctggtgtggatgtaacgaaagaatcc
attcccattgtgcccaccgttcactactccatgggtggcgtccccacgctttggacgggt
gaggtcgtaaacccacgcaatggtgatgacgatgcgattgtaccgggtctccttgcggca
ggggagtgcgcttgcgcgagcgttcatggcgctaatcggctgggcgccaactcgctgctg
gacattgtggtgtttggtaagtcgtgcgccaacaccgtcatttttaacctaacgaaagag
ggacgggcgcaacccgagttgcgatcagatgcaggtgagagttccattgctgatcttgac
aaaatccttcataataagggtgatatccccgttgcccgcattcgtgagcgcatgaaggaa
acaatggctctctacgctgccgtgttccggacggaggagagcatgcttaagggccaagca
atcatcgaggaatgctacagggattactcacatgttttcgtccacgacaagtctccagta
tggaacagcaacctcattgaggcacttgagttacggaatttactttacaacgcactcatg
acaatcgctagtgcggcagcgcggcgggagtcccgtggggcccatgcgcgtgacgactac
ccggagcgggatgaccacaactggatgaagcacacgcttgcgtacattaatgataaggag
ggtaaagcgaaactggcttaccgccgtgtgcacagtgagatgttgacaagtgaattagat
agcattccgccagcgaagcgcgtctactag

DBGET integrated database retrieval system