KEGG   Thermococcus barossii: A3L01_07510Help
Entry
A3L01_07510       CDS       T05081                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tbs  Thermococcus barossii
Pathway
tbs00030  Pentose phosphate pathway
tbs01100  Metabolic pathways
tbs01120  Microbial metabolism in diverse environments
tbs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A3L01_07510
Enzymes [BR:tbs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     A3L01_07510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ASJ05221
UniProt: A0A2Z2MSE4
LinkDB All DBs
Position
1373599..1375416
Genome map
AA seq 605 aa AA seqDB search
MFAYWGKILRVNLTDGTIKEEHFDENFAKKWLGTRGFGIYFLLKEMDPTVDPLSPENKII
YTTGPLTGTTAPTGGRYMVITKSPLTGYIAMANSGGFFGAELKFAGWDAIIVEGASDHPV
YLYINDESVELRDASHLWGKTSTETEEALKEEIGDKRIRAALIGPAGENLVRFAAVMNDE
HRAAGRGGVGAVMGSKKLKAIVVRGHKRVEVADRAKFTSVVKEKTDKLRNDPVAGGGLPK
YGTAVLVNIINQNGLYPTKNFQYSQFEYAEEQSGEAMTAKYLIRNKPCYACPIGCGRVNK
LPTTGVTEGPEYESIWALGAHNGINDLASIIEANHWADEYGMDTISLGGTLATAMELYEK
GLLKQEDLGEEAPPFRWGNTEVLHYYIEKIAKREGFGDKLAEGGYRLAEMYGGTEYFMGV
KKQELPAYDPRGAEGHGLGYATNNRGGCHIKQYMISPEILGYPYKMDPHDIGDEKIKLVI
LFQDLTALIDAAGLCVFTTFGLGADDYRDMINAATGWDFSTEEYLKVGERIWNAERLFNL
RAGLDPLKEDTLPKRLLEEPVRNGPNKGHVVRLHLMLPKYYKFRGWTEDGKITEEKAKEL
GLDEF
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcgtactggggaaaaattttgagagtgaacctgacggacgggaccattaaagaa
gagcactttgacgagaacttcgcaaagaagtggctgggcacgaggggcttcggaatctac
ttcctcctgaaggagatggacccaaccgttgacccgctgagcccggagaataagattatc
tacaccaccgggccactaaccggtacgacggccccgaccggtggaaggtacatggtaata
accaagagcccgctgaccggttacatagccatggcgaactcgggcggattcttcggtgct
gaactcaagttcgccggctgggacgccatcatagtggagggagcgtccgaccacccggtt
tacctctacataaacgacgagagcgtcgagctcagggacgcaagccacctctggggcaag
acctctaccgagaccgaggaggccctgaaggaggaaatcggggacaagcgcataagggcg
gccctaattggtccggctggagagaacctcgtcaggttcgccgcggttatgaacgacgag
cacagggcagccggtaggggcggtgtcggtgctgtaatgggaagcaagaagctgaaggcg
atagtcgttcgcggccacaagcgcgttgaagtggccgacagggcgaagttcacaagcgtc
gtcaaggagaagaccgacaagctgagaaacgaccccgttgccggcggtggactacctaag
tacggaaccgctgttctcgttaacataatcaaccagaacggtctctatccgacaaagaac
ttccagtacagccagtttgagtacgctgaggagcagagcggtgaggcgatgacggccaag
tacctgataaggaacaagccgtgctacgcctgtccgataggctgtggaagggtgaacaag
ctcccgaccacaggagtcacagaggggccggagtacgagagcatctgggcgctcggagca
cacaacggcattaacgacctcgcgagcatcatcgaggccaaccactgggccgacgagtac
ggtatggacaccataagcctcggcggaacccttgcgactgcgatggagctctacgagaaa
ggcctgctcaagcaggaggacctcggcgaggaggcgccgcccttcaggtggggcaacacg
gaggttctccactactacatagagaagattgccaagagggagggcttcggtgacaagctc
gctgagggcggctaccggctggccgagatgtacggtggaaccgagtacttcatgggcgtc
aagaagcaggagcttcctgcatatgacccaaggggagcagagggacacggtctcggctac
gccaccaacaaccgtggcggctgccacatcaagcagtacatgataagccctgagattctc
ggctacccgtacaagatggacccgcacgacatcggcgacgagaagataaagctggtcatc
ctgttccaggacctcacagctctcatcgacgccgctggactgtgtgtcttcacaaccttc
ggtctcggcgccgacgactaccgcgacatgataaacgccgccaccggctgggacttctca
accgaggagtatctcaaggtgggagagcgcatctggaacgccgagaggctcttcaacctc
agggccggcctcgacccgctcaaggaggacaccctgccgaagagactgcttgaggagccg
gtcaggaacgggccgaacaagggtcatgtcgtcaggctgcacctgatgcttccgaagtac
tacaagttccgcggctggaccgaggacggaaagataaccgaggagaaggcaaaagaactc
ggcctggacgagttctga

DBGET integrated database retrieval system