KEGG   Thermococcus barossii: A3L01_08205Help
Entry
A3L01_08205       CDS       T05081                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tbs  Thermococcus barossii
Pathway
tbs00010  Glycolysis / Gluconeogenesis
tbs00020  Citrate cycle (TCA cycle)
tbs00620  Pyruvate metabolism
tbs00633  Nitrotoluene degradation
tbs00640  Propanoate metabolism
tbs00650  Butanoate metabolism
tbs00680  Methane metabolism
tbs00720  Carbon fixation pathways in prokaryotes
tbs01100  Metabolic pathways
tbs01110  Biosynthesis of secondary metabolites
tbs01120  Microbial metabolism in diverse environments
tbs01130  Biosynthesis of antibiotics
tbs01200  Carbon metabolism
Module
tbs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3L01_08205 (porA)
   00020 Citrate cycle (TCA cycle)
    A3L01_08205 (porA)
   00620 Pyruvate metabolism
    A3L01_08205 (porA)
   00640 Propanoate metabolism
    A3L01_08205 (porA)
   00650 Butanoate metabolism
    A3L01_08205 (porA)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    A3L01_08205 (porA)
   00680 Methane metabolism
    A3L01_08205 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    A3L01_08205 (porA)
Enzymes [BR:tbs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     A3L01_08205 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ASJ05344
UniProt: A0A2Z2MNC5
LinkDB All DBs
Position
1505585..1506769
Genome map
AA seq 394 aa AA seqDB search
MPMRKVMKANEAAAWAAKLAKPKVIAAFPITPSTLVPEKISEFVADGELDAEFIKVESEH
SAISACVGASAAGVRTFTATASQGLALMHEILFIAAGMRLPIVIAVGNRSLSAPINIWND
WQDSISERDTGWMQFYAENNQEALDLILIAYKVAEDERVLLPAMVGFDAFILTHTVEPVE
IPDQELVDEFLGEYEPKHAYLDPARPITQGTLAFPAHYMEARYTLWEANENAKKVIDEVF
AEFEKKFGRKYQKIEEYRTEDAEIIFVTMGSLAGTVKEYVDHLREKGIKAGAAKLTVYRP
FPIEEVRALAKKAKVLALLEKNVTFSVGGALFQDFSRALINESEKPVIVDFILGLGGRDV
TFKDLDEALAIAQKALNGEEFDEVNWIGLRKEIL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgagaaaggttatgaaggccaacgaagccgccgcctgggcggccaagctcgcc
aagccgaaggtcatagcggccttcccgattacgccatcaacgctcgttccagagaagatt
agcgagttcgtcgcggatggggagcttgacgcagagttcatcaaggtcgagagcgagcac
tccgccatttcagcctgtgtgggtgcctccgctgcgggcgtaagaaccttcaccgccaca
gcctcccagggtctcgccctgatgcacgagatactcttcatcgccgcagggatgcgcctt
ccgatagtcatcgccgttggaaaccgctccctgagcgctcctatcaacatctggaacgac
tggcaggacagcataagcgagcgcgacaccggctggatgcagttttacgccgagaacaac
caggaggccctcgatttaatcctcatcgcatacaaggtcgccgaggacgagcgcgttctc
ctcccggcgatggtcggcttcgacgcgttcatactcacccacaccgtcgagccggtcgag
attccggatcaggagctcgttgacgagttcctcggcgagtacgagcccaagcacgcctac
ctcgatccggccaggccgataacccagggcaccctcgccttcccggcccactacatggag
gcccgctacaccctctgggaggccaacgagaacgcgaagaaggtcattgacgaggtcttt
gccgagttcgagaagaagtttggaagaaagtaccagaagatagaggagtacaggacggag
gatgccgagataatcttcgtcacgatgggctcgctcgccggtacagtcaaggagtacgtc
gaccacctccgcgagaagggcatcaaggccggtgctgccaagctcaccgtctacaggccg
ttcccgatcgaggaggtaagggcgctggcgaagaaggcgaaggttctcgcgctccttgag
aagaacgtcaccttcagcgtcggcggagctctcttccaggacttcagcagggctttgata
aacgagagcgagaagccggtcattgttgacttcatcctcggcctaggaggaagggacgtc
accttcaaggacctcgacgaggcactcgcgattgcccagaaggccctcaacggggaggag
tttgacgaggtcaactggatcggcctgaggaaggagattctgtga

DBGET integrated database retrieval system