KEGG   Thermococcus barossii: A3L01_08240Help
Entry
A3L01_08240       CDS       T05081                                 

Definition
(GenBank) 4Fe-4S ferredoxin
  KO
K00196  anaerobic carbon-monoxide dehydrogenase iron sulfur subunit
Organism
tbs  Thermococcus barossii
Pathway
tbs00633  Nitrotoluene degradation
tbs00680  Methane metabolism
tbs00720  Carbon fixation pathways in prokaryotes
tbs01100  Metabolic pathways
tbs01120  Microbial metabolism in diverse environments
tbs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbs00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    A3L01_08240
   00680 Methane metabolism
    A3L01_08240
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    A3L01_08240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Fer4_7 Fer4 Fer4_6 Fer4_10 Fer4_9 Fer4_2 Fer4_16 Fer4_4 Fer4_21 Fer4_3 Fer4_17 Fer4_8 Pectinesterase
Motif
Other DBs
NCBI-ProteinID: ASJ05351
UniProt: A0A2Z2MSQ2
LinkDB All DBs
Position
complement(1512351..1512956)
Genome map
AA seq 201 aa AA seqDB search
MPTDSKPTIFINPAKCIGCRQCEIACAVEHSQSKDLFSAIFEDPLPLPRIHILPMGAYNV
PMNCRHCDGAPCVEVCPTGALYHDEDGAVMITPEKCIGCKMCAIVCPFGIPEFEALNGVM
FKCDLCPDRRAEGRPPACVEACKTGALMFGTIDEVVSQVRKETAEKIIKLKEGTYEEEYN
GWDLFRSMYAEIIRINEGESK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccgattcaaagcctaccattttcataaatccagcaaagtgcattggatgtcgg
cagtgtgagatagcgtgtgcagtggagcattcccagagcaaggacctgttctcggcgatc
tttgaggaccccctgcctctgccgaggatacacatcctgccgatgggcgcctacaacgtg
cccatgaactgccggcactgcgacggcgcaccgtgcgttgaggtatgccccaccggcgcg
ctctaccatgacgaggacggcgcggtaatgataactcccgagaagtgcatcggatgtaag
atgtgtgccatcgtctgtccattcggtatccccgagttcgaagccctcaacggcgtgatg
ttcaagtgcgacctgtgccccgacaggagggccgagggcagaccgcccgcctgtgttgag
gcgtgcaagaccggagcgctgatgttcggcaccatagacgaggtagtctcgcaggtcagg
aaggagaccgctgagaagataatcaagctgaaggaaggcacgtacgaggaggaatacaac
ggttgggaccttttcaggtccatgtacgccgaaattattcgtattaatgagggggagtcg
aaatga

DBGET integrated database retrieval system