KEGG   Tribolium castaneum (red flour beetle): 100142029
Entry
100142029         CDS       T01046                                 

Gene name
FGF-2
Definition
(RefSeq) fibroblast growth factor 2
  KO
K18496  fibroblast growth factor 1
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tca04052]
    100142029 (FGF-2)
   00536 Glycosaminoglycan binding proteins [BR:tca00536]
    100142029 (FGF-2)
Cytokines and growth factors [BR:tca04052]
 Growth factors
  Growth factors (RTK binding)
   100142029 (FGF-2)
Glycosaminoglycan binding proteins [BR:tca00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100142029 (FGF-2)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100142029
NCBI-ProteinID: XP_001813599
LinkDB
Position
LG8
AA seq 146 aa
MDEKPSWHGNVMRLRSENGFNLTIQDDGHVLGTRDDNLDNVLVVSSSGEISHVRIQGAKS
KRYLCFDDSGNLYAEEDKNKDGAIFKEILQGSYNGYVSKNHPDWYIGIKKDGNMKNGKRT
QWGKKSVKFLPNRNVSEAELQQLDSS
NT seq 441 nt   +upstreamnt  +downstreamnt
atggacgaaaagccaagctggcatgggaatgtaatgagactcaggtccgaaaatgggttt
aatttgaccatacaagatgatgggcacgttttgggcacaagggatgataatttagacaat
gtcctggttgttagttcaagtggggagatttcccatgtcaggattcaaggagcgaagagt
aaacggtatctgtgttttgacgattcgggaaatttgtacgcggaagaagacaaaaataaa
gacggggccatttttaaagaaatccttcaaggttcgtacaacggatatgtatcaaaaaat
catccggactggtacattgggattaaaaaagatgggaacatgaagaatggaaaacggacg
cagtggggcaaaaaatcagtgaaatttttgcccaacagaaatgtatcggaagcggaattg
caacagctagactccagttga

DBGET integrated database retrieval system