KEGG   Tribolium castaneum (red flour beetle): 103315192
Entry
103315192         CDS       T01046                                 

Definition
(RefSeq) uncharacterized LOC103315192
  KO
K05459  insulin-like growth factor 1
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04068  FoxO signaling pathway
tca04150  mTOR signaling pathway
tca04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103315192
   04150 mTOR signaling pathway
    103315192
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    103315192
Cytokines and growth factors [BR:tca04052]
 Growth factors
  Growth factors (RTK binding)
   103315192
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 103315192
NCBI-ProteinID: XP_008201468
UniProt: D6W956
LinkDB
Position
LG2
AA seq 177 aa
MNVPKLWLKVCFTLLLAGQIHANIDRKEFFCGKKLVKTLTELCAIYNYPTLPRRRFRRQI
VDECCRSQCSRRYLVQYYCMEAHSSIAHLLKAKPEPEKPPERPVEAPKETPVGTTPSHIS
PNHGHCKCRKRRAKRINKSKRMQGQRNFIHNPVPPANIGHVERSQTPFYIWKFSRVY
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaacgtgccaaaactctggcttaaagtctgcttcaccttgctcctcgccggccagatc
cacgcaaacatcgaccgaaaagagttcttctgcgggaaaaaattggtgaagactctcacc
gaactgtgcgctatttacaattacccgactttgcctaggagacgttttcggcggcaaata
gtggacgaatgttgccggtcgcagtgctctcgccggtatttggttcagtattattgcatg
gaagcccacagctcgattgcgcacctcctcaaagccaagcccgagccggagaaacccccg
gaaaggcccgttgaagcgcccaaagagacccctgtaggtaccaccccctctcacatttca
ccaaaccatgggcattgcaaatgcaggaaaaggcgggcgaagaggataaataaatcgaag
aggatgcaagggcagaggaatttcattcataatccggtgcctccggccaatattggccac
gtcgaacgctcacaaacgccgttctatatttggaaattctcgagggtttattaa

DBGET integrated database retrieval system