KEGG   Tribolium castaneum (red flour beetle): 655044Help
Entry
655044            CDS       T01046                                 

Definition
(RefSeq) histone deacetylase Rpd3
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04213  Longevity regulating pathway - multiple species
tca04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    655044
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    655044
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tca03036]
    655044
Enzymes [BR:tca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     655044
Chromosome and associated proteins [BR:tca03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     655044
   HDAC complexes
    Sin3A-HDAC complex
     655044
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    655044
  Chromatin remodeling factors
   NuRD complex
    655044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 655044
NCBI-ProteinID: XP_966633
UniProt: D6WG88
LinkDB All DBs
Position
LG3
AA seq 490 aa AA seqDB search
MATQPHSRKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAT
AEEMTKFHSDDYIRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAA
AVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDESYEKI
FVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFMMVGG
GGYTIRNVSRAWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLD
KIKTRLFENLRMLPHAPGVQVQAIPEDAINEESDGEEKVDKDERLPQKDLDKRIVPENEF
SDSEDEGEGGRRDNRTYKGRKRPRLEKGVDGKESTGDEKIKEELKSEKEEKEDSKANTID
DLKKDTGPTP
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggccacacaacctcacagtcggaaacgtgtttgttactattacgacagcgatattggg
aattactattatgggcaaggacaccccatgaagccccaccgcataaggatgacccataat
ttgctgctcaattatggtctgtacagaaaaatggagatttatcgcccccataaagccact
gccgaagaaatgaccaagtttcactcggatgactacattcgatttctcagatccatccga
cctgacaacatgtctgagtacaacaaacaaatgcagaggtttaatgtaggggaggactgt
cctgtctttgacggtttgtacgaattctgccaactctcagctgggggctcagtggcggca
gctgttaaattgaacaagcaagcgtccgaaatttgcatcaattggggcgggggtttgcat
cacgcgaaaaaatccgaagcttcgggcttttgctacgtaaatgatattgttctggggatt
ttggagctgttgaagtaccaccaacgcgtgttgtacatcgatattgacgtgcaccacggt
gacggtgtcgaagaggctttttacaccactgaccgggtgatgacagtctcgttccacaaa
tacggcgagtacttccccggaacgggcgatctcagagacattggcgccggcaaaggcaag
tactacgccgtcaatatcccccttcgtgacggcatggacgacgaatcctacgagaagatt
ttcgttccgataatcagcaaagttatggagacgttccaaccgagcgctgttgttctccaa
tgtggtgcagactccttaactggtgaccgcctggggtgcttcaacctcacggtgcgaggc
cacggcaagtgcgtggagttcgtcaaaaagtacaaccttccattcatgatggtcggaggt
ggtggatacaccattaggaacgtctccagagcatggacgtacgaaacttccgtcgctcta
ggtgtggaaatcgccaacgaactcccttataacgactacttcgagtactttggtcccgat
tttaagctacatatcagtccgagcaatatggccaatcagaacacccccgagtatttggat
aaaatcaagacgcgcttgtttgaaaatttgaggatgttgccgcacgcaccaggtgtgcaa
gttcaggcgattccagaagacgcgatcaatgaagaatcggatggagaggagaaagttgac
aaagacgagagactacctcagaaagatctcgataagaggatcgtgccagaaaatgaattt
tccgatagtgaggacgagggagaaggggggcgaagagacaatcggacgtataagggacga
aagaggccgcggcttgaaaaaggggttgatgggaaagaatcaacaggggatgaaaaaatc
aaagaagaactaaaatctgaaaaagaagagaaagaagatagtaaagcgaacacaattgat
gatttgaagaaagatacgggaccaactccgtga

DBGET integrated database retrieval system