KEGG   Tribolium castaneum (red flour beetle): 655678Help
Entry
655678            CDS       T01046                                 

Gene name
P76, GLEAN_07017
Definition
(RefSeq) serine protease P76
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    655678 (P76)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tca01002]
    655678 (P76)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    655678 (P76)
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     655678 (P76)
Peptidases [BR:tca01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   655678 (P76)
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   655678 (P76)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Toxin_4
Motif
Other DBs
NCBI-GeneID: 655678
NCBI-ProteinID: NP_001164207
BEETLEBASE: TC007017
UniProt: D2A2R8
LinkDB All DBs
Position
LG4
AA seq 258 aa AA seqDB search
MKSFLLIVFLVATASAVPSYLRTNSLLPDGRIIGGSSISISSVPWQVSLQYYGSHICGGS
IISAKYIVTAAHCTDGLTAAQLSIRAGTSSRGSGGQVSSVARIYQHSSYNSRTIDYDISI
LELSSSLTLGSNVSPVSLPSSSTSWNAGTSVLVTGWGTTSEGSSSLPSALQGVTVQIVSQ
STCSSAYGSGSITGRMLCAGVTNGGKDACQGDSGGPLVVGNVLAGIVSWGAGCGRPSYPG
VYSNVPALRSFIQQTTGI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcctttttgctgattgtttttctggtcgcaactgcttctgcggtaccatcttac
cttcggaccaacagtttgttgcccgatggtcgtattattggtggttcctcaatttctatc
tcttcggtaccttggcaagtgtctctgcaatattatggttctcacatttgtggtggttcc
ataatcagcgccaaatatattgtcacagctgctcattgcaccgatggtttgactgctgct
caactgtccatccgtgctggcacttcgtctcgtggttccggtggacaagtatctagcgtg
gccagaatttaccaacattccagttacaacagcagaaccatcgattacgacatttccatc
ctcgaattgtccagttctttgactttgggttcgaacgtatctccagtctcccttccttca
tctagtacctcatggaacgcaggaacttctgtccttgtcaccggctggggcaccacctct
gaaggttccagttcgcttcctagtgctttgcaaggagttactgtccaaatcgttagccaa
tcgacttgctcatcggcttatgggtctggaagtattaccggtcggatgttgtgtgctggt
gttaccaatgggggcaaggacgcatgccagggtgactctggaggtcctttggtggttggt
aatgtccttgctgggattgtttcttggggtgcgggatgtggacggcctagctatcctggg
gtttattccaatgttccggcgcttcgtagcttcattcaacaaaccacagggatttaa

DBGET integrated database retrieval system