KEGG   Tribolium castaneum (red flour beetle): 655978
Entry
655978            CDS       T01046                                 

Definition
(RefSeq) ephrin-A4
  KO
K05463  ephrin-B
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   655978
Cytokines and growth factors [BR:tca04052]
 Growth factors
  Growth factors (RTK binding)
   655978
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 655978
NCBI-ProteinID: XP_008200035
UniProt: D6W6N4
LinkDB
Position
LGX
AA seq 287 aa
MAVLIKKCSLILPGFRTTSCLTVVLLVCMETVFLCTQSTCSKTFQVHWNTSDSIFHIDNT
DHIIDVNKGNAQFEYDQVNIICPVYTPGTYGDDLEKYIIYNVSKEEYETCRITNPNPRII
AICDKPYKLMYFTITFRPFTPQPGGLEFLPGKDYYFISTSSKDDLHRRIGGRCSSNNMKI
VFKVCCAPDQSQANFTTKLTSTSTTTLGWPDIHRPMVEATSSSTTQWAPRTDAPPTRKPT
KKMNEYEKHPNEVMKNEELTYSKGVWLSAGPPSFLVVIACIAVIRWR
NT seq 864 nt   +upstreamnt  +downstreamnt
atggccgtgttaataaagaagtgcagtttgatcttgccggggtttagaacaacctcctgc
ctgaccgttgtgttgctcgtctgcatggagaccgtcttcttgtgcacgcagtccacctgc
tcaaaaacattccaggttcactggaataccagcgatagcatatttcacatcgacaacact
gaccacatcatcgacgtaaataagggcaacgcccaatttgaatacgaccaagtcaacatc
atctgtccggtgtacacgccaggaacgtacggagatgacttagaaaaatacatcatttac
aacgtatcgaaggaggagtacgaaacctgccgaataaccaaccccaacccccgaataata
gccatatgcgacaaaccgtacaaacttatgtatttcacaattacatttcgcccttttacg
ccccagcccggcggcttggagttcctccccggcaaagattactactttatatcgacgtcg
tcaaaggacgacctccaccgccggatcgggggccggtgctcctccaacaacatgaaaatc
gtcttcaaagtgtgctgcgcccccgaccagagccaggccaacttcacgacgaaattaacc
tcgacctcgacgacgacgctgggctggccggacatccaccggcccatggtcgaagcgacg
tcgtcgtcgaccacgcaatgggcccctcggacggacgcgccgccgacgcggaaacccacc
aagaaaatgaacgagtacgagaagcatccgaacgaagtcatgaaaaatgaagagttgacg
tacagcaaaggagtctggctatcggcgggcccgccgagttttctagttgtcattgcctgc
atcgcagtcatccgatggcggtga

DBGET integrated database retrieval system