KEGG   Tribolium castaneum (red flour beetle): 656682Help
Entry
656682            CDS       T01046                                 

Gene name
SOD
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04146  Peroxisome
tca04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    656682 (SOD)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    656682 (SOD)
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     656682 (SOD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 656682
NCBI-ProteinID: XP_015835141
UniProt: D2A2T2
LinkDB All DBs
Position
LG4
AA seq 153 aa AA seqDB search
MPTKAVCVLNGEVKGTIFFTQENGKAPVQVTGEVSGLKKGLHGFHIHEFGDNTNGCISAG
AHFNPHGKDHGGPTHDVRHVGDLGNIEAGGDGVAKVGITDKFISLEGEHSIIGRTLVVHA
DPDDLGQGGHELSKTTGNAGARLACGVVGITKA
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgaaagcagtttgtgtcctaaacggcgaagttaaggggaccattttcttcaca
caagaaaatggtaaagccccggtgcaagtcaccggcgaggtgagtgggctcaagaagggg
ctgcatgggttccatatccacgagtttggggataataccaatgggtgcatttcggctggg
gcccacttcaacccccatggaaaggatcatggagggcccacccatgacgtacgtcatgtg
ggggatttggggaatatcgaagccgggggtgatggagttgccaaagttggtattactgat
aagtttatctcgttggaaggggagcatagcattattgggcgcactttagtggttcatgcc
gatccggatgatttgggacaagggggccatgaattgagcaagactacagggaatgctggc
gctcgtttggcgtgtggtgttgttggaatcactaaagcttaa

DBGET integrated database retrieval system