KEGG   Tribolium castaneum (red flour beetle): 657390Help
Entry
657390            CDS       T01046                                 

Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00052  Galactose metabolism
tca00500  Starch and sucrose metabolism
tca01100  Metabolic pathways
tca04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    657390
   00500 Starch and sucrose metabolism
    657390
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    657390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    657390
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     657390
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   657390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil zf-ZPR1
Motif
Other DBs
NCBI-GeneID: 657390
NCBI-ProteinID: XP_968946
LinkDB All DBs
Position
LG2
AA seq 845 aa AA seqDB search
MEFILEQNEIREDYKVKPKASPVIIIWRKKPTKGLLTLFVFAIVVPVLVYFFIFDKGTFP
VEDANTCSVDKKYRITCGITDINATYDYCTNIKCCFDNATRLCYHYLPSKYFYYNKGGNS
QTYDRSLEKSPFGQDLTKEISLTINEIDENNVQIILHDTAVTVDSNQVLDKNYKVNVSNN
PLFVEISRNTSGDILLTTADGPLIVSGNFREWSFQLTDQYLFGLGQVLIDLDENSTLTKV
IYANNNDHNTLPLFMAHKNGQYHGLVVRHSGLLEITILPSKLVSLKSLEREKIVLELSVG
PTPHDVITQQRKGKWGTIDMKTLGVHICREGTVTTLKDILSDYSQEKSIDFPYESDCFHD
NLVTALRKEKSEQNIENVLEKIKSLTDSGHSFMLSVPPHIVFGSALYDNGTQLGIFYKSG
NKTYKGQYLKNTVVFPFFKHTSIDSFVQLLVEELKGYFKDTFPRDFILNNNWPKDDSFVF
ENYENFRFFSKEIIDAMSYTLPWDVSSENQSQILDHNDYGALQTQKFLGVLTESSVMTAA
HNFETTQPLIIQNVAISWVNFKKSITQILYNSIAGSPMTSVPVCGSTSDFDASAHEALCT
RWYLMGATAPIFRISSDLPRRDPTSLGPGAFGQAARRAIEVRYSLLYYYNTVLNQDKEPL
MRPMFYDFPTDNDTFPLVDQYMVGRHLLVAHPTLPDRTQITIYLPKAVKVWYEFWGGEAF
GAWSNKTWVTLTLVDTDLVAFVKEGGIIPWVTDNQGTKLVQLKVALKCDSDNNCDAEGSM
MVGLESLVFKSTDKNLTVTKSGDLGDKKFVLTEIIIFQMGTKARYVKLTEGKNLNEITDT
WTYNF
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atggagtttattcttgaacaaaacgaaattcgcgaagattacaaagtgaaaccaaaggca
tcaccagtgataataatttggcgaaagaaacccactaaaggtctcctaactcttttcgtt
tttgccatcgtagtcccggtccttgtttacttttttatattcgataaaggaacgtttcca
gtcgaagacgcaaacacttgctctgttgacaaaaaatacaggataacgtgtggtataaca
gacataaatgcaacatacgattactgcaccaatatcaagtgttgttttgataacgcaact
agactgtgttatcactatttaccatcgaagtacttttattacaataaaggagggaattca
caaacgtacgacagaagtttggaaaaatcgccttttgggcaagatttaaccaaagaaatt
tcgctaacaatcaacgaaattgatgaaaataatgtccaaattattttgcacgacactgct
gtaacagtagactcaaatcaagtccttgataagaattacaaagtcaatgtgagcaataat
cccttgtttgtggaaatttcgagaaacacttccggagatatccttctaacaacagcagat
ggccctttgatagtatcaggaaacttcagagaatggtcgtttcaactcacagatcagtac
ttattcggcttgggccaagtcctgatcgatttggacgaaaactcaactctcactaaagtc
atttatgctaacaacaacgaccacaacactttaccattgttcatggcccacaaaaatgga
caataccatgggttggtggtacggcacagtggccttctcgagattacgatactaccgtcc
aaattagtcagtttgaaaagtttagaacgggaaaaaattgtcttggagctaagtgttggg
ccaacaccacacgatgtgataacacagcagaggaaaggaaaatgggggacaattgacatg
aaaacactcggagtccacatttgcagggaaggaactgtcactactcttaaagacattcta
agtgattatagtcaagagaaaagtattgattttccatacgaatctgactgttttcacgat
aatttagttacggccttgaggaaagaaaagtcggagcaaaatattgaaaacgtgcttgaa
aaaattaaaagtttgactgatagcgggcacagttttatgctctcggtgcccccacatatt
gttttcggcagtgcactctacgataatggaacccaattgggcattttttacaagagtggt
aataaaacgtacaaaggacagtacctcaaaaacaccgttgtctttcctttttttaaacac
acatccattgattcgtttgtgcaactactggttgaagaactgaaaggttatttcaaagac
acgttcccgcgtgactttatcctgaataacaattggccaaaagacgactctttcgttttc
gaaaattacgaaaacttccgtttcttttcaaaagaaataatcgacgccatgtcttacact
cttccatgggacgtttcgagtgaaaaccagtcacaaattttggaccataacgactatggg
gcccttcaaacccaaaaatttttgggtgttttaaccgaaagttccgtcatgaccgcggca
cacaatttcgaaaccacccaacccctcataatccaaaacgtggctatttcttgggtcaac
ttcaaaaaatccataacccaaattttgtacaacagcattgctggtagtccaatgaccagt
gtcccggtttgtggttcgaccagtgatttcgatgcttccgcacacgaggctttgtgtacc
agatggtacctcatgggtgccacggcacccattttccgcatttcgtccgatctaccaaga
cgggacccgacgtctttgggtcctggggcgttcggacaggcggcccgaagggccattgaa
gttagatacagtctgctttattattacaacactgtgttaaaccaggacaaagagccgtta
atgaggccaatgttttacgattttccgaccgataacgacacttttcctttggtcgatcag
tacatggtgggtaggcacttgctggtggcacacccgactttgcctgaccggacacaaatt
acgatttatttacccaaagcggtcaaggtctggtatgagttttggggaggcgaagccttt
ggtgcttggagcaacaagacctgggttactttaactctggttgatactgatttggttgcg
ttcgtaaaggaaggagggattattccgtgggttactgataaccaaggcactaaactggta
caactgaaagtggccctaaagtgtgatagtgataacaactgtgatgctgaaggttccatg
atggttggattagaatcgttggtttttaaatcaactgacaaaaatttaaccgtcactaaa
agtggagaccttggtgataaaaaattcgttttgactgaaataatcatattccaaatgggc
actaaagcgagatatgttaagctgactgaaggaaagaatttaaacgaaattactgacact
tggacctacaacttttaa

DBGET integrated database retrieval system