KEGG   Tribolium castaneum (red flour beetle): 658170Help
Entry
658170            CDS       T01046                                 

Gene name
Ance-3, GLEAN_02092
Definition
(RefSeq) angiotensin-converting enzyme 3
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tca01002]
    658170 (Ance-3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    658170 (Ance-3)
   04090 CD Molecules [BR:tca04090]
    658170 (Ance-3)
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     658170 (Ance-3)
Peptidases [BR:tca01002]
 Metallo Peptidases
  Family M2
   658170 (Ance-3)
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   658170 (Ance-3)
CD molecules [BR:tca04090]
 Proteins
  658170 (Ance-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 658170
NCBI-ProteinID: NP_001164243
BEETLEBASE: TC002092
LinkDB All DBs
Position
LG10
AA seq 702 aa AA seqDB search
MCDISNNRKFATFVLLTRLVLAQNPNFQPQTIDYNPQNPNYNQNQNVDYNSQNFEPVDDN
RFRPNEGFDRGPSGDVRALLQALDLQGSQECTRNVAAQWDFETNVNQATQLEALNAQQVY
SQFQHGVWELLNKVSLRNVPNSSVARQIRYLSIVGPAALSPDQLDRYNRLINDMLAIYNS
ASICALKEPFRCGLRLQPDLTNIMAFSRNWDELQYTWTEWRRNTGQNIKDLFEQMIGLSN
EAARLNNFTDTADYWSFPFESSTLSLDLEDAWEDVKPLYELLHAYVRRKLRDYYGPERLN
RQAPLPAHILGNMWAQSWSNIFDISQPYPGQNFLDVTPEMLKQGYTPLDIFRLAEDFFVS
LNMSAMPLDFWQGSVVEEPLDRVVLCQPSAWDFCNRRDFRIKMCTNINMKDLITAHHEMA
HIHYFMLYKNQPKVFRDGANPAFHEAIGEAVGLSVGTPKHLQSLGLLQNSVADSSVDINF
LYLMALDKVVFLPFAYVVDKWRYDVFNGNVGKEQYNCHWWRLSEQYMGIKPPVLRSEKDF
DPGAKYHIPANIPYLRYFVSTLLQFQIYRALCRAAGQYDPADVSRPLHKCDIYRSKEAGR
ILTQMMEKGSSLPWKEVLYQTTGETRLDGSAMREYFRPLEDWLRNENLRTQEFVGWLYDG
DYCKQSIETAGLQVYGGFYNGGFTRKPLTVTFVVALLVYVMT
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgatattagtaacaatcggaagtttgccacctttgtgctcctaacgcgcctcgtt
ctggcacaaaaccccaacttccagccccaaactattgactacaacccacaaaatcccaac
tacaaccaaaaccaaaatgtggactacaatagtcaaaatttcgagccagtggacgataac
aggtttcggccgaacgagggttttgaccgcgggccgagtggtgacgtccgagctttgctg
caagctctggacctgcagggctcgcaggaatgcacgcgaaatgtcgccgctcagtgggat
tttgaaacgaatgtcaatcaggcaacgcaattggaagccttgaatgcgcaacaagtctac
tcgcaattccagcacggagtttgggaacttttgaataaagtgagtctcagaaatgtccca
aattcttcagtggccaggcagattaggtacttgtccatagtaggccctgcagccttatcg
ccagaccaacttgatcgatataatagactgatcaatgacatgctggccatctacaacagc
gcctccatctgcgccctgaaggagcccttcaggtgcggcctgcgcctgcagccggacctg
accaacatcatggccttcagcaggaactgggacgaactccagtacacctggaccgagtgg
agacgcaacacaggccaaaatatcaaggacttgttcgagcaaatgatcggactgtccaac
gaagctgcaagactgaataattttaccgacacggccgactactggagcttccccttcgag
tcgtcgacgctcagtctggacctggaggacgcctgggaggacgtgaagccgctctacgag
cttttgcacgcctatgtcaggaggaagttgagggattattatggacctgaacgacttaat
cggcaggcgccacttcctgcccatattttggggaacatgtgggcgcagtcctggagcaat
attttcgatattagtcagccgtatccaggccagaatttcctggacgttactccagaaatg
ctcaaacagggctacactcctcttgatattttccgccttgctgaagatttcttcgtttcg
ctcaacatgagtgccatgcccttagatttctggcaaggttccgtcgttgaagagccttta
gatcgggtggttttatgccaaccatcagcctgggatttttgcaatcgtcgcgattttagg
attaaaatgtgcacaaacatcaacatgaaagacctcatcaccgcgcaccacgaaatggcc
cacattcattacttcatgctctacaagaaccaaccaaaagtgttcagagacggagctaat
ccagcttttcatgaggccatcggcgaagccgtgggactttcagtcggaaccccaaaacat
ttacaaagcttgggcttgctgcaaaattcggtggctgactcctctgttgatataaatttt
ttgtacttgatggcacttgataaagtggtgtttttgccctttgcttacgttgtggacaag
tggcgctatgatgtttttaacggaaacgtgggcaaagaacaatataactgccactggtgg
cgtttgagtgaacaatatatggggattaaaccaccggttttgcgctcagagaaggatttt
gacccgggggcgaagtaccacatcccggccaacatcccctacttgaggtactttgtgagc
acgctgctgcagttccagatatacagggcgttgtgcagggccgcaggacagtatgatccg
gctgatgtttcgaggccactccataaatgtgatatctacaggagcaaggaagctgggcgc
atcttgacacaaatgatggaaaaaggctcctcgctgccatggaaggaggtcttgtaccaa
accacgggcgagacaagactcgacggaagcgcaatgcgcgagtacttccggcctctggag
gactggctcaggaacgagaatctcaggactcaggagttcgtcgggtggctttacgacggc
gattattgcaagcagagcatcgaaacggccggcttgcaagtgtatggtgggttttataat
ggggggttcacacggaagccgcttacggttacgtttgtggttgcgttactggtgtatgta
atgacatga

DBGET integrated database retrieval system