KEGG   Tribolium castaneum (red flour beetle): 658192Help
Entry
658192            CDS       T01046                                 

Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00052  Galactose metabolism
tca00500  Starch and sucrose metabolism
tca01100  Metabolic pathways
tca04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    658192
   00500 Starch and sucrose metabolism
    658192
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    658192
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    658192
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     658192
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   658192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 658192
NCBI-ProteinID: XP_969694
UniProt: D6WDN8
LinkDB All DBs
Position
LG3
AA seq 1011 aa AA seqDB search
MTRIRYLLQAFRSRRRNRHLSRTDSVSFEAFCNEIPPQKCPATKESSLNGDFNSSPLKRE
RLEEDYVRFAPQNCESTTCSRPSLPAILLVLMLLAVFLVLPLVYLLHCFGVIYTQERYEH
PTLLEKIHHTHKSSETKVPTALPPPPKPDYGKCKLVQERDRFDCYPENGANQQGCEARGC
CWIPAKKKPKMGVPLATPYCFYPSNYGTYNYVNVTQTAYGLEAFLKRGYATAYPGDVEII
KLSAKFETETRLHIKISDPLKNRFEPPFPEVPIVDKAAMNLSYLFYIDSTKPGFRVVRRS
DNTIIFDALSLPNLIFSDQFLQLSGKLPSNYIYGIGEHRTRLLLSTQWSRFTLFNHDAIP
SFEKNLYGSHPFYLIMENSTKSHGFYLQNSNAMDVILQPTPAITFRPIGGVLDFYFFLGP
TPSDVISQYTDLIGRPFMPPYWGLGFHLCRFGYKTLNRTKLVMQRNIDAGIPLDTQWNDL
DYMKSSNDFTYDSVNFKGLPQFVKDLHLKGMHYIPLIDAGVSGSEPPGSYPPFDEGLKMD
IFVKNSSGKIFIGKVWNNKTTVWPDFTHPTTVDYWTMMLKSLHDIVPFDGAWIDMNEPSN
FLSGSFNGCPKTSLDSPPYLPSVDGGALNYKTMCMSAKHYAGLHYNVHNLFGFTEAIVTS
FAMSDIRGRRPMVISRSTFAGHGHYAGHWSGDVVSDWLDMRYTIPQLLSFSLFGVPLMGA
DICGFNGNTTRSLCNRWTQLGAFYPFSRNHNTDDGIDQDPVAMGPEVVMSARKALSMRYK
LLPYLYTLFWAAHTRGDTVARPLFFEFPTDLKTYDIDTQFLWGPALMIVPVLEENSTEVT
AYLPEGLWYDIYTKSPIAGQGQSVNLSAPLDTIPVLLRGGYILPTQAPEQTTTRSRLNRI
EIVAAGDEQMNAFGEFYWDDGDSLNSYEEKQYTLIDFWMERGVLRSENIFWSGTENPPNL
GAVTIVGITDSVEEVLVNNVAQAFRYDTIHKYLLIENLNVELQKPVVVTWK
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgaattcgttatttgctgcaagcattccggtcccggcggcgtaaccgccactta
tcccgcactgattccgtgtctttcgaggccttctgtaacgaaatcccgccacagaagtgc
cccgcaaccaaagaatcatccctaaatggcgacttcaactcctcaccgctcaaaagagaa
cgcctggaggaagattacgtccgcttcgccccacagaactgcgaatccaccacttgctcc
cgtcctagtctgccggcaatcctgctggtgctcatgcttctggctgtgtttttagtcctt
cccttggtatatttgttacattgttttggagttatttacactcaagaacgctacgaacac
ccgactttactcgaaaaaatccaccacacgcacaaatccagcgaaaccaaagttcctaca
gctctgccgccgcccccgaaaccggattatggtaaatgcaaactggtccaagagcgcgat
cggttcgattgctatcctgagaatggggccaatcagcaggggtgcgaggccaggggctgc
tgctggatcccggcgaaaaagaagccgaaaatgggggtgcccctggccaccccttactgt
ttctatccctccaattacgggacctataattacgtaaatgtgacgcagacggcctacggt
ctggaggcgtttttgaaaagggggtacgcaacggcctatcctggagatgttgaaattatt
aaacttagtgccaagtttgagacggaaacgaggctgcatattaagatttcagatccgctg
aaaaacaggtttgaacccccttttcctgaagttcctatcgtcgataaagcggccatgaat
ttgagttacctgttttatattgactcgactaagcccggttttcgggtggtaagacgctca
gataataccataatctttgacgcattaagtttgccaaatttaattttttctgatcagttt
ttacaactgagcggtaagttaccgtctaattatatttacggaattggagaacaccgcact
cgtttattgttatcgacccaatggtccagattcacgttattcaaccatgacgcaatacca
tcttttgaaaaaaatttatacggcagtcatcctttttatctaattatggaaaactcgact
aaaagccacggtttttacctccaaaactccaacgctatggatgttattctccaacccacc
cccgctataacattccgaccaatcggcggtgtcctagacttctattttttccttggcccc
acccccagtgacgtaatcagccaatacacggatttgattgggcggccgttcatgccgcca
tattgggggttgggctttcatttatgtcggttcggttacaaaactttgaaccgaactaaa
ctcgtgatgcaacgtaacatcgatgccgggattccattggacacacaatggaacgatttg
gactacatgaaaagtagcaacgattttacttacgattccgtcaatttcaaaggtttgcct
cagtttgttaaagatttacatttgaaagggatgcattatataccgttgattgacgcgggg
gttagtgggagtgagcctccagggtcgtaccccccatttgacgaaggcctcaaaatggat
atttttgtaaaaaattcgagtggaaaaatttttattgggaaagtttggaataacaaaact
acagtttggcccgactttacacatcctacgactgtggactattggacaatgatgctgaag
tcgctccatgatattgtacccttcgatggggcctggattgacatgaatgaaccttcgaat
ttcctctcgggctcgtttaatgggtgccccaagactagtctagacagccccccttacttg
ccaagtgtcgacggtggcgccctcaattacaaaacaatgtgcatgtcggcgaaacactac
gctgggttgcactacaacgtgcacaatttgtttggtttcaccgaggcaatcgttacaagt
ttcgccatgtctgacattcgggggcgccgccctatggtcatatcccgctcgaccttcgcc
ggccatggccactatgccggtcactggagcggtgacgtcgtctctgattggctagacatg
agatacaccattccacaattattaagtttcagccttttcggagtccctttaatgggggcc
gacatttgtggcttcaacggcaacaccactaggagtttgtgtaaccggtggacccaactg
ggggctttttatcccttttcgcggaaccacaacacggacgatggcattgatcaagacccg
gtcgccatgggccccgaagtggtcatgtcggcccgcaaggccctctcgatgcgctacaaa
ctgctcccctacttgtacactttgttctgggcggcgcacactagaggcgacaccgtcgcg
cgtcccctattttttgaatttccaaccgatttgaaaacttacgatatcgatacgcaattt
ttgtggggccctgctttgatgattgttcccgttttagaggagaattcgaccgaagtcacg
gcctacttgccggaagggttgtggtacgatatttacaccaaatcaccaattgcaggccaa
ggccaaagtgtgaatctctcagcccccttggatacgatcccggttttgttacgagggggc
tatatcttgccaacgcaagcccctgaacagaccacaacccgctcgcggttaaaccgaatt
gagatcgtagcagccggcgatgaacaaatgaatgcgtttggggagttttattgggatgat
ggcgattcgttgaattcctacgaggaaaaacaatacactttgattgatttttggatggag
aggggggtcctaagaagcgagaatatcttttggagtgggacagaaaaccccccaaatttg
ggcgcagtgactatcgttggtattactgattcggtcgaggaggttttggtgaataatgtg
gcgcaagctttccgttacgacactatccataagtatttgttgattgaaaatctgaatgtt
gaattacagaaacctgtagtcgttacatggaaataa

DBGET integrated database retrieval system