KEGG   Tribolium castaneum (red flour beetle): 658335Help
Entry
658335            CDS       T01046                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tca01002]
    658335
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    658335
   04090 CD molecules [BR:tca04090]
    658335
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     658335
Peptidases [BR:tca01002]
 Metallo Peptidases
  Family M2
   658335
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   658335
CD molecules [BR:tca04090]
 Proteins
  658335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Tn7_Tnp_TnsA_N
Motif
Other DBs
NCBI-GeneID: 658335
NCBI-ProteinID: XP_008198828
LinkDB All DBs
Position
LG10
AA seq 628 aa AA seqDB search
MDLVLVLVLGLLVHAGGATDPEIEDEELRARDFLQFLNKKNEESSNRLVLAEWAYASNIT
EQNLQNKLAVSAEVAKEHKKDWEEVTKFNWNTFSDPDLKRQFKKYSKLGSDALPEAKLNR
YQKIISEMEKIYSTAKICDFHNSSKCDLSLEPHLTQILATSRNEEELRHVWVEWRNAVGP
HCKVLFEEYVDLANEAARLNNFTNNAENWLDNYEDAQFRGQIEGLWEQLKPLYLQIHAYV
RFKLREKYGEVVSEKGPIPAHLLGNMWAQKWRTVSEFTLPYPDKKDEDITSELKKQNYTA
VKIFQTAEDFFKSINLTEMPETFWERSILTKPNDREIVCHASAWDFYDRKDFRIKQCTQI
TLEHFITAHHEMGHVEYFIQYKNQPIPFREGANSGFHEAVGDLIALSVESRKHLRKLGXL
KSEKDDPENVLNNLFQIGLDKIVFLPFGYLMDLWRWDVFEGKITPDEYNCKWWELREKYQ
GVEPPLNRSEGDFDPAAKYHIVASVPYIRYFVSFVVQFQFHKALCEKAGQYDPNDPSKPL
HECDIYQSTEAGNALKKMLQLGSSKPWHEAMELLTGHKTMDASAILEYFKPLQKWLENEN
QKNGAFIGWEKSTKVCVNSQKGEKPKSK
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggatttggtcttggttttggttttggggcttttggtgcatgctggaggtgcaactgat
ccagaaattgaagatgaagagttgcgagctagggattttcttcaatttttgaacaagaag
aatgaagaaagcagtaatcggcttgtgctggcagaatgggcctatgcttcaaacatcacg
gagcaaaatctccaaaataagctagctgtgagcgccgaagtggccaaagaacacaaaaaa
gactgggaagaagtcaccaaattcaactggaacaccttctcagacccagacctcaaacgc
caatttaagaaatactcaaaactgggctcggacgcactcccggaggccaaactcaaccgc
taccagaaaatcatcagcgagatggaaaaaatctactcaactgcgaaaatctgcgacttt
cacaactcctcaaagtgcgatctttcgctcgaaccgcacttgactcaaattttggcgact
tcgcgcaatgaggaggagttgaggcacgtttgggttgagtggaggaacgctgtggggccg
cactgtaaggtgctttttgaggagtatgtcgatttggccaatgaggcggcaaggcttaat
aattttacgaataatgcggagaattggttggataattacgaggatgcgcagtttagagga
cagattgaggggctgtgggagcagctgaagccgctctatttgcaaatacacgcctatgtg
aggttcaagttgagggagaagtatggcgaagttgtgtcggagaaagggccaattccggcg
catctcttaggcaacatgtgggctcaaaaatggagaactgtatccgaattcacccttcct
taccctgacaaaaaagatgaagatattacatccgaactaaaaaaacagaactacaccgcc
gtaaaaatcttccaaaccgctgaagacttcttcaaatcaattaacttaaccgaaatgcct
gaaactttctgggagagatcaattctaaccaaaccaaacgaccgcgaaatcgtctgtcat
gcctcagcttgggacttctacgaccgcaaagacttcaggatcaaacagtgcacccaaatc
accctggaacacttcatcacagcccaccacgaaatgggacacgttgaatacttcatccag
tacaaaaaccaacccattcccttcagagagggtgctaacagcggatttcatgaagccgtg
ggcgatttgatcgcactttcagtcgaatcgcgcaaacatttgcgcaaacttgganctctg
aagagcgaaaaggacgatcctgaaaacgtgttaaataacctatttcagatcggacttgat
aaaattgtcttccttccttttggttatttgatggatttgtggagatgggacgttttcgag
gggaaaatcaccccagatgagtacaattgcaagtggtgggagctgagggagaagtaccaa
ggggtggaaccgccccttaatcgctcagagggtgactttgacccagctgccaagtaccac
atcgttgccagcgtgccctatattagatattttgtaagctttgtggtccagttccagttc
cataaggccctttgtgaaaaagcgggtcaatatgaccccaatgacccctcgaagcccttg
cacgagtgtgatatttatcaaagtactgaagctggaaatgccctcaaaaaaatgcttcag
ttaggttcgtccaagccatggcacgaggcgatggaacttttgacaggtcataaaacaatg
gacgctagcgccatcttggaatattttaagccgttgcagaaatggttggaaaatgaaaat
cagaaaaatggagcttttattggatgggaaaagtctacgaaagtttgtgtcaatagtcaa
aaaggggaaaaaccgaagtcgaaatga

DBGET integrated database retrieval system