KEGG   Tribolium castaneum (red flour beetle): 658633Help
Entry
658633            CDS       T01046                                 

Definition
(RefSeq) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03030  DNA replication
tca03410  Base excision repair
tca03420  Nucleotide excision repair
tca03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    658633
   03410 Base excision repair
    658633
   03420 Nucleotide excision repair
    658633
   03430 Mismatch repair
    658633
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tca03032]
    658633
   03400 DNA repair and recombination proteins [BR:tca03400]
    658633
Enzymes [BR:tca01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     658633
    6.5.1.6  DNA ligase (ATP or NAD+)
     658633
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     658633
DNA replication proteins [BR:tca03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    658633
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     658633
DNA repair and recombination proteins [BR:tca03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     658633
   NER (nucleotide excision repair)
    Other NER factors
     658633
   MMR (mismatch exicision repair)
    Other MMR factors
     658633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme BRICHOS
Motif
Other DBs
NCBI-GeneID: 658633
NCBI-ProteinID: NP_001164142
BEETLEBASE: TC003800
LinkDB All DBs
Position
LG3
AA seq 756 aa AA seqDB search
MFHFHFKRLVTNYRTINSCLPQLRKIAVSDGGPLQAKQSGKRPRKSSSADSSPDVKKACP
SSASPEKSDKENKKNVEKSPKVASPSQTPVKSLLAKDSGENDSYNPNVAKYHPLEDATWR
QGERVPYIALTRTLEEIGSISSRLKIIEILSNFFRSVILLSPDDLLPSLYLCLNKLGPAY
EGLELGVAETSLMKAIASSTGRSMSQIKTDCQELGDLGLVAEQSKTNQRMLFQPARLTVF
GVFEKLKEIAKLTGHASQTKKIEKIQTMFVACKKSEARFLIRSLTGKLRIGLAEQSVLQA
LALACTLNPPNSKSPVKSVNVAKKIASDDFKENYDKLALILKTTYCECPNYDMIIPRLLS
DGIEKLPEYCKLTPGIPLKPMLAHPTKGIQEVLHRFDGLKFTCEWKYDGERAQIHISGKD
VFIFSRNQENNTSKYPDIISRIDKCKDEKVQSCVLDCEAVAWDRERKVILPFQILSTRKR
KDADESSIKVQVCVFMFDLLYLNGESLVKKPFIERRNLLKEHFKEVEGEWCFVTSLDTNT
MEEVQEFLEESIKGNCEGLMVKTLEKEATYEIAKRSHNWLKLKKDYLDSCGDTLDLVVIG
GYLGKGKRTGTYGGFLLACYDQESEEFQSICKIGTGFSDEALQQHSEFLKNHVIQGPKPY
YRFDGSHEPDHWFDSVQVWEVKCADLSLSPVHRAGIGIVDSEKGISLRFPRFVRIREDKS
SEEATSSQQVASMYSNQEQVKNQAGTSNKAAEEDFY
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatttccactttaaaagactagttacaaattaccgaacaattaattcatgttta
ccccaacttagaaaaattgccgtctctgatgggggccccttgcaagcgaaacaaagtggt
aagaggccaaggaagtcaagcagtgctgatagttccccagatgtcaagaaggcatgtccc
tccagtgcctctccagaaaagtcggataaagagaacaaaaagaatgtggaaaagtcacct
aaagtagcttcgcccagtcaaacgccagtaaaatctctgctagctaaagattctggcgaa
aatgattcgtataatccaaatgttgcaaaatatcatcctcttgaagatgccacctggagg
caaggtgaacgagtgccatatatcgccttaactcgaacattggaggaaattggaagtata
tcaagcagattaaaaataattgaaattttaagtaactttttccgttctgtaatactccta
agccctgatgatttgttgccgtcgctttatttgtgtttgaataagcttggcccggcctat
gaaggtcttgagcttggtgttgctgaaaccagtctaatgaaagcaattgcctcttccact
ggtcgatcgatgtcgcaaataaaaaccgattgtcaggaattaggtgaccttggtttggtc
gctgaacagtcaaaaacaaaccaaagaatgctttttcaacctgcacgtcttacagttttt
ggcgtttttgaaaaattgaaagaaatcgccaaattgaccggacacgcttcacaaactaag
aaaattgaaaaaattcaaacaatgttcgtggcttgtaaaaaatcggaagcacgattttta
atccgttcactgactggtaaattacgaattggattggcagaacagtcagttttgcaagca
ctggctttggcgtgtactctaaacccgccaaattcgaaatcgccagtgaaaagtgtgaat
gtagcgaaaaaaattgcctcggatgatttcaaagagaattatgataagttggctctgatc
cttaaaaccacttattgcgagtgccctaattacgacatgataattccaaggttgttatcg
gacggaattgaaaaattgcccgaatattgcaaactcactccagggattcccctgaagccc
atgttggcgcatcctacgaaaggaatccaggaggttttgcaccgatttgatgggctgaag
tttacttgcgaatggaagtatgacggggagagagctcagattcacataagcggcaaagac
gttttcatatttagccgtaatcaagaaaacaacacttctaaataccccgacatcatatct
cgaatagacaaatgtaaagacgaaaaggtgcaatcatgtgttcttgattgtgaagctgtt
gcttgggatcgagaaagaaaagtcattcttccttttcaaattctcagtacccggaagcgt
aaagatgcggatgaatcgtcaatcaaagtccaagtttgtgtcttcatgtttgatctttta
tacttaaacggcgaatcattagtgaaaaaaccgttcatcgaacgtcgaaatctcctaaaa
gagcatttcaaagaagtggaaggggagtggtgttttgtcacttctctagatacaaacact
atggaagaagtccaagaattcctagaggagagtatcaagggaaattgtgagggtttaatg
gtgaaaactttggaaaaggaagccacgtacgaaatcgccaaacgctcacacaattggctc
aaactgaaaaaagactacttggacagttgtggcgatactctcgatctagtggtcattggg
ggttatctgggcaaagggaaacggacgggaacctacggaggctttctcttggcttgctat
gatcaagaaagcgaggagttccaaagcatttgcaagattggaactggattttcggatgaa
gcccttcaacaacattctgaatttttgaaaaatcacgttattcagggtccaaaaccatat
tacaggtttgatgggagtcatgagccggaccactggtttgattcggtgcaagtgtgggag
gtgaaatgcgccgatttgtcactctctcccgtacacagagcaggaattggaattgttgat
tctgagaagggaatttcgctacgattccctagatttgtccgtataagagaggataagtct
tcagaagaggcaacatcgtcgcaacaggtcgcttcaatgtattctaaccaagaacaagtg
aagaatcaagctggtacaagcaacaaagcggccgaggaagacttctattaa

DBGET integrated database retrieval system