KEGG   Tribolium castaneum (red flour beetle): 660655
Entry
660655            CDS       T01046                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04068  FoxO signaling pathway
tca04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    660655
   04068 FoxO signaling pathway
    660655
SSDB
Motif
Pfam: Cyclin_N Cyclin_C DUF1981
Other DBs
NCBI-GeneID: 660655
NCBI-ProteinID: XP_008192557
UniProt: D2A0U5
LinkDB
Position
LG4
AA seq 302 aa
MMDILRCCETTENEITAFVDGTLLQDRVLKNMLQSEYRCVPSNVFINQREITESMIEIVG
GWMMEVCEEQTCQDDVFLLSMNYLYRFLTTTNIKKNQLQLLGAACMLIASKLREPKPLSA
EMLVFYTDHSITTNMLTSWELLVLSKLKWDIIAIVPVDFLPHLLVRLDFERLGIKAEMVK
KHAKILITLCAKECRFTNCYPSLLACASVVSALCGLGWVNKYHQSQEALLKTLADIIDVQ
ETDFMQELVQNIDQMIKQNFENVKDNKVCDEVTRSEQCTPPPGKIRDYKTATTPTDVHDV
CF
NT seq 909 nt   +upstreamnt  +downstreamnt
atgatggatatactgcgttgttgcgaaacaaccgaaaatgaaattacggccttcgttgac
ggcactttgttgcaagaccgggtcttaaaaaacatgttacagtctgaataccggtgtgtg
ccctccaacgtgtttattaatcaacgggagatcaccgagtctatgatcgagatcgtcggg
ggttggatgatggaggtatgcgaagaacagacgtgtcaagacgacgtcttcctcctctcc
atgaactacctgtacaggttcctcaccaccaccaacatcaagaagaaccagctgcagctg
ctgggggcggcgtgcatgctcatcgcctccaagttaagggagcccaaacctttatcagcc
gagatgttggttttctataccgaccacagcattactaccaacatgctcacgtcctgggag
ctgctggtgctcagcaagctgaaatgggacatcatcgccatcgtgccggtggacttcctg
ccgcacctgctggtgcgcctggacttcgagcggctgggcatcaaagccgagatggtcaag
aagcacgcaaagatcctcataaccctctgcgcaaaagaatgccgatttacgaattgttat
ccgagtctgctggcttgtgctagcgtggtgtcggcgctgtgcggcctaggatgggtcaac
aagtaccaccaatcgcaagaagccctcctcaagacactagcggatattatcgacgtgcaa
gaaacggatttcatgcaagagttggtgcagaacatcgaccaaatgatcaaacagaatttc
gagaacgttaaagacaataaagtgtgtgacgaagtgacgaggtcagaacaatgtactcct
cctcctggaaaaattcgcgactacaagacggcgactacgccgaccgatgtgcatgatgtt
tgtttttga

DBGET integrated database retrieval system