KEGG   Tribolium castaneum (red flour beetle): 660692Help
Entry
660692            CDS       T01046                                 

Definition
(RefSeq) transketolase-like protein 2
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00030  Pentose phosphate pathway
tca01100  Metabolic pathways
tca01200  Carbon metabolism
tca01230  Biosynthesis of amino acids
Module
tca_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
tca_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    660692
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    660692
Enzymes [BR:tca01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     660692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh TPP_enzyme_C DXP_synthase_N XFP_N
Motif
Other DBs
NCBI-GeneID: 660692
NCBI-ProteinID: XP_008200734
LinkDB All DBs
Position
LGX
AA seq 625 aa AA seqDB search
MPAQITQADIKVLQDIANRIRIHSVTSTAACNSGHPTSCSSIAEILSVLFFNTMRYKISA
PKDPSSDRFVLSKGHAAPALYAVWAEAGLFPVADLQNLRKLGSDLEGHPTPRLNFIDVGT
GSLGQGLAIACGMAYVGKNFDKASYRVYCLVGDGESAEGSIWESLHFATYYKLDNLCVIF
DVNRLGQSEPTSLGHDIDTYRKRLEAFGFNVVAVDGHDVEELVKAFHVSCNTKGKPTAII
AKTFKGKNFPKIEDLENWHGKPLGDQADRVLQHLKSLVKNTGPLQLHPQKPLTDDAPIVD
ISNIKLSSPPSYKIGDSIATRVAYGTALVKLGQSNPRVIALDGDMKNSTYSEALKKFDPT
RYIECFIAEQNLVGVAIGATCRDRTVAFVSTFATFLTRAYDQIRMGAISQTNVNFCGSHC
GVSIGEDGPSQMGLEDIAMFRTIPGSTVFYPADAVSTERAVELAANTKGVTFIRTNRPAT
AVIYPNNHVFQVGKSHVVKKSNNDQVLVIGGGVTLQEAIGAANELAKAGVGVRVLDLFTI
KPIDKEGIIKNAKECGGRILVVEDHYYEGGIGEAVLSAVAQERNIAVKHVAVPKVPRSGS
PTALLDYYGLNSKHIVNYVQEAMKL
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgccggctcaaatcactcaagctgatatcaaagtcttgcaagacattgccaatagaatc
agaattcacagtgtcacctccacggcggcttgcaactcagggcatccaacatcatgctcg
tcaatcgccgaaattttatcggtcctttttttcaacacaatgcgatacaaaatatcagca
ccgaaagacccctcaagtgaccgctttgtcctttctaaaggtcacgccgctccggcgctg
tacgcagtatgggccgaggcgggtcttttccccgttgctgatttacaaaacttgaggaaa
ttggggtcggacctcgagggtcatccaactcctcgcttgaatttcattgatgtagggaca
ggctcgctgggccaagggctggccattgcgtgcggcatggcctacgtgggcaaaaacttc
gacaaggccagttatagggtgtactgcctggtcggggatggggagagcgccgagggttca
atctgggaatcgctccattttgcgacttactacaagctcgataatctctgcgttatcttt
gatgtgaaccgtctcgggcaatctgagcccacttctctgggtcatgatatcgacacttac
aggaaacggttggaagcgttcggtttcaatgtagttgccgtcgatggacacgacgtcgaa
gagctggtgaaagccttccacgtgtcgtgcaacaccaaagggaagcctaccgcaatcatt
gcgaaaactttcaaagggaagaacttccccaaaattgaagatttggaaaactggcacggg
aaaccactaggagatcaggccgatcgtgtcctccaacacctcaaatctcttgttaaaaac
acggggcctttgcaactccacccccagaagcccctcaccgacgatgctcccattgttgac
atcagcaatattaaactatcctcgcctccatcttacaaaatcggcgatagtattgctacg
agagtggcctacggcactgctttggtcaagctcggccaaagcaacccccgagtcattgcc
cttgacggcgatatgaaaaattcaacatattcggaagcccttaaaaaatttgaccccacg
agatacatcgaatgtttcatcgccgaacagaaccttgtcggggttgccattggtgctact
tgtcgcgaccgcacagttgccttcgtttccacctttgctactttcttaacccgtgcttat
gaccagattcgtatgggggctatttctcagacaaatgtcaatttctgcggctctcattgt
ggtgtcagtataggcgaagacggaccaagccagatggggctggaagacatcgctatgttc
cggaccatccccggaagcactgtcttctaccccgctgatgcggtctccactgaacgtgcc
gtcgaactggccgcgaacaccaaaggagtcactttcatcagaaccaacagaccggccact
gctgtcatctaccccaacaatcacgtattccaggtgggcaagtcgcacgtggtgaagaag
tcgaacaacgaccaagtcctggttattggtggcggagtgaccctgcaggaggccatcggg
gccgccaacgaattggctaaagccggtgttggtgtccgtgttttggatctgttcaccatc
aagccaattgacaaggagggaataatcaaaaacgcgaaagaatgcggtgggcgtattctc
gtcgttgaagaccactactacgaggggggcattggcgaggctgtcctttcggcggtcgct
caggagcgcaacatcgccgtgaaacacgtggcagtgcccaaagtgccccgctccgggagc
cccaccgcccttttggactactacggcctcaacagcaaacacattgtcaattacgtgcaa
gaagcaatgaagttgtaa

DBGET integrated database retrieval system