KEGG   Tribolium castaneum (red flour beetle): 660954Help
Entry
660954            CDS       T01046                                 

Definition
(RefSeq) C-terminal-binding protein
  KO
K04496  C-terminal binding protein
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04310  Wnt signaling pathway
tca04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    660954
   04330 Notch signaling pathway
    660954
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    660954
Membrane trafficking [BR:tca04131]
 Endocytosis
  Macropinocytosis
   Others
    660954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 660954
NCBI-ProteinID: XP_008197859
LinkDB All DBs
Position
LG9
AA seq 446 aa AA seqDB search
MDKRKMMAKRPRVENLRGPISNGPMQTRPLVALLDGRDCSIEMPILKDVATVAFCDAQST
SEIHEKVLNEAVGALMWHTIVLTKEDLEKFKTLRIIVRIGSGVDNIDVKAAGELGIAVCN
VPGYGVEEVADTTLCLILNLYRRTYWLANMVREGKKFTGPEQVREAAQGCARIRGDTLGI
VGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIEKSLGLTRVYTLQDLLFQSDCVSLHCTL
NEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDDALAQALKQGRIRAAALDVHENEPYNV
FSGPLKDAPNLLCTPHAAFYSDASATELREMAASEIRRAIMGRIPECLRNCVNKEYFMSP
GSYPEGTVSPAGVNGGYYQGGGALPVQQAHSTTPHEAPHTVTPSAAPPTPQPAPPVGPVV
PPHALPISTPDPANHHATKPEPSEVH
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacgaaaaatgatggcaaaaaggcctagagttgaaaatttgcgcggtccaatt
tcgaacgggccgatgcagacccgaccattagtggcgttattggacggaagagactgttcc
atcgaaatgccgatattgaaggacgtggccacggtggcgttctgtgacgcgcagagcacc
agtgagatccacgagaaagtgttgaacgaggcggtcggagccctaatgtggcacaccatc
gttttaactaaggaagatctcgaaaagttcaaaacgttgcgtatcatcgtgcgcataggc
agtggcgtcgataacatcgacgttaaagcggcaggggagctcggcatcgccgtctgtaac
gtccccggctacggcgtcgaggaagtcgccgatacgacgttgtgtctcattttgaatttg
taccgacggacctattggttggcgaacatggtgagggagggtaagaagttcaccggtcca
gaacaagtgcgggaggcggcccaaggatgcgccaggatacgtggggatactctcggaatc
gtcgggctcggcaggatcggctcggcggtggcacttcgcgccaaagccttcggcttcaac
gtcatcttctacgatccctatctccccgacggcatcgagaagagtctaggactgacgcgg
gtctacacgctccaggaccttttgtttcaatcggattgcgtgtccctgcactgcacccta
aacgaacacaaccatcatctaatcaacgagtttaccatcaagcagatgcgaccgggggcc
tttttggtgaatacggcgcgcggtggtctcgtcgacgacgatgccttagctcaagcctta
aaacagggtcgcattcgagctgcggcgttggacgtccacgaaaacgaaccgtacaatgtg
ttctcgggaccattgaaagacgccccgaatctgttgtgtactccacatgcagccttttat
agtgacgcttcagcaacagaacttagggaaatggcagcgtcggaaataaggcgcgccatc
atgggcaggatcccggagtgtttaagaaattgcgtcaataaggaatatttcatgagcccg
ggctcatatcccgaaggtacagtgtccccggctggggtaaacggaggctactaccaaggt
ggtggtgcacttcccgtccaacaggcacactccacgacacctcacgaagcccctcacacg
gtaactcccagtgctgcgccacccacacctcagccggccccgccagtgggtccagtggtc
ccaccccatgctctcccgataagtacgccagatccggcgaatcaccatgcaacaaaacca
gaaccgtcagaggtccactaa

DBGET integrated database retrieval system