KEGG   Tribolium castaneum (red flour beetle): 661035Help
Entry
661035            CDS       T01046                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00040  Pentose and glucuronate interconversions
tca00051  Fructose and mannose metabolism
tca01100  Metabolic pathways
Module
tca_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    661035
   00051 Fructose and mannose metabolism
    661035
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     661035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C CRS1_YhbY
Motif
Other DBs
NCBI-GeneID: 661035
NCBI-ProteinID: XP_972317
LinkDB All DBs
Position
LG2
AA seq 356 aa AA seqDB search
MAPKDNLTAVLYGINDMRLEQRPIPVPKPNQVLLKMEVVGICGSDVHYLVSGRIGPFVVT
DPMVIGHEASGTVIQVGRDVKNLKPGDRVAIEPGITCRTCADCKSGNYHLCKDMIFCATP
PVDGNLTRYYVHDADFCHKLPDNMDLEEGALMEPLSVGVHACRRAGVRIGSVVLVLGAGP
IGLVSMLTAKAMGASKVIITDIVGHRLQKAKELGADFTLQIGQNTTEEEIVSEIKAKLGE
DPNITLECTGAEQCVRVALQVTKSGGTVILVGLGKFEMTVPLAGALVREVNIRGVFRYNN
DYPIAIEMVKTGKVNVKPLITHHYKMEDTLKAFHTAKTGEGNPIKVLIHANPDWKP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaggataacttaacagccgttttgtacggcatcaacgacatgcgacttgaa
caaagaccaatccctgtccccaaaccaaatcaagtacttcttaaaatggaagtcgtgggt
atttgtggctccgatgtccattacttggtcagtggcagaattggcccttttgtggttaca
gatcccatggttataggacacgaagcctccggaacggtaatacaagtcggacgcgacgtc
aaaaatcttaaaccaggtgatcgtgtggctatcgagcctggaataacttgccgcacttgt
gctgactgcaaaagcggcaattaccacctgtgcaaggacatgattttttgtgcaactccg
ccagttgatgggaatttgactagatattacgtccacgatgccgatttttgccacaagttg
cccgataacatggacttggaagagggtgcccttatggagcccctctccgtgggtgtccac
gcgtgcaggagggccggagtgcgcataggttccgtggttttggttctaggtgctggcccg
attggtctagtttcaatgcttacagccaaggcaatgggtgcttccaaagtcataattaca
gatattgtgggccaccgattgcaaaaagctaaagagttaggtgctgatttcaccctacaa
attggtcaaaacacgactgaagaagaaatcgtgtcagagattaaagcaaaattgggggaa
gacccgaatatcactttggaatgcacgggggccgaacaatgcgtccgagttgctttacaa
gtcacaaaatccggaggtactgttattttggtaggtttagggaaatttgaaatgaccgtg
cctctggcgggtgctttggtacgcgaagtcaacatacgtggagtgttccgatacaataat
gattatccgatcgcaatcgaaatggtcaaaacaggcaaagttaatgtgaaaccactaata
acgcaccactataaaatggaagatacgctgaaagcttttcacactgctaagacaggcgaa
ggaaatccgatcaaggtgttaatacacgcgaatcctgactggaaaccgtaa

DBGET integrated database retrieval system