KEGG   Tribolium castaneum (red flour beetle): 661193Help
Entry
661193            CDS       T01046                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EHMT2
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    661193
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tca03036]
    661193
Enzymes [BR:tca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     661193
Chromosome and associated proteins [BR:tca03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     661193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_3 SET Ank Ank_5 Pre-SET
Motif
Other DBs
NCBI-GeneID: 661193
NCBI-ProteinID: XP_008198704
UniProt: D6X453
LinkDB All DBs
Position
LG10
AA seq 925 aa AA seqDB search
MNSGESESESSNSGSEDKSTIIHKILGEMKSEFNSPRADDAPNTNDEEKPRIILSFKKPA
SDESPPVGGRRSLRYKNPEEKPELKRSARRRSKDCSESVLQSAIARKEKSYNESNKPQRL
TRQLKPTQKILENLALAKMEKSRFFECEESERLVRKHKHKHNKCRRLKRAKLGQGDSEKE
TDSDEGGCRRPRSENVDEGEELEGAKDTCLCRRRTKFFLATNEETAYCAAVDSIDDKLIG
CGRTVATKDLMLLRPSTRVPYTIFCDLHKSRLLRHNCCPTCGIFCTQGRFVQCENKHQYH
KDCQSEVDCCPHCGISGISYQVDIVMQLGKKPVFLPVQKAQYITARMTFSTLKTEESKCM
TPPLIPIGSFEFDNSFEYGDEVYEMNELIVAVKNNALEKIATILGSKTLDVNSKIPECQD
GTILHIAAEKGNVSIVHMLVVAGTQTDVYDKDQNTPLMAAVMAANNETVRYLIKTGADIH
LKGTDGMTALHLAAKCGNLHACQLLVDNSPRKAVNCQDDGGWTPLVWACEHGYGDVATFL
INKGADPSVRDVEHNVALHWAAFSGSCHIAGLLLDKGCDVNAVNAHGDTPLHIGARQDMY
DCNVVLLARGADVTLLNKNNESPLDCVPAGGDTYSVIALNVTLGGAYNSQNVVLCNDITK
GRESNPIQCYNSVDNATNPNDFKYVTKNCITSDDVKIEAKITDLQCCQCEERCVTDDCQC
GKLSLRCWYDEEGKLIPEFNFGDIPMIFECNDRCQCNAITCNNRVVQKGPNQRFELFKTL
DKGWGIRTLRPISRGSFICEYIGEIITDSEADKREDDSFLFDLENRVCKNEDVDSYCIDA
KFYGNFARFINHSCNPNLTSVKVFIDHQDLRFPRIAFFANRDISNEEELSFDYGEKFWLA
KYKLFSCLCGSLECKYSEDTIGMRT
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtggtgaaagtgagtccgaatcgagtaattccggcagtgaggacaagtcaaca
atcatccacaaaatccttggcgaaatgaaaagtgaattcaacagcccccgagctgacgac
gcccccaataccaacgacgaagaaaaaccccgaattattctctcctttaaaaaacctgct
tcggatgagtcgcccccagttggggggcggcgctccctccgttacaaaaacccggaggaa
aagcccgaattgaaacgttctgcaaggaggcgcagtaaagactgctccgagtcggtttta
cagagcgctattgcacgtaaagaaaagtcctacaatgagtcaaataagccccaaagactt
acaagacaattgaaaccgactcagaaaattttagaaaatttagcgttggctaaaatggaa
aagagtcggttttttgaatgtgaggagagcgaaagacttgtaagaaaacacaaacataag
cataacaagtgtcggaggctgaaaagggccaaattggggcaaggggacagcgagaaagag
actgattcggatgaagggggctgtcggaggccgaggagcgaaaatgtggacgaaggggag
gagttggagggggccaaagacacgtgcttgtgtcggagaaggacgaagttttttctcgca
acgaatgaagagacggcctactgcgccgccgtggacagcatcgatgataaattgattggt
tgtggtcgcactgtagccacgaaagacttgatgttgttgcgaccttcaacccgtgttcca
tacacgattttttgcgatttgcataaaagtcgtctcttgcgtcataattgttgtccaacg
tgtggtattttttgtacacagggacgtttcgtccaatgtgagaacaaacatcagtatcat
aaagactgtcaaagtgaagttgattgttgtccacattgtggtatttctggtatttcgtat
caagttgatatcgtaatgcaattggggaaaaaaccggtttttttgcccgtacaaaaagcg
caatatattacggcaagaatgacattttcgactttaaaaacagaagaatccaaatgtatg
acgccacctttgatcccaatcggatcgtttgaatttgacaattcattcgaatatggcgac
gaagtgtacgaaatgaacgaattaattgtcgctgttaaaaataatgcactggaaaaaatt
gccacgattttaggttcgaaaacattggacgtcaacagcaaaatcccagaatgccaagac
ggtacaatactccatatagcggccgaaaaaggcaatgtttcaattgtccatatgctggtc
gtagccgggacacaaaccgatgtttacgacaaagatcaaaacacaccgttaatggcggcc
gtaatggccgccaataacgaaactgtccgttatttaataaaaacaggcgccgacatccat
cttaaaggcactgacggcatgacagcacttcatctagcggcaaaatgtggtaatttacac
gcatgtcaactactcgttgacaactcgccacgtaaagctgtcaattgtcaagatgacggc
ggttggacaccccttgtatgggcgtgtgagcatggttacggcgacgttgccacatttctg
attaacaaaggggcggatccgtctgtacgtgacgttgaacataatgttgcacttcattgg
gctgcgtttagtggaagttgtcatattgccggtctcttattggataagggatgtgacgtc
aatgcggttaacgcacatggtgacacccccttacatatcggtgcacgtcaagatatgtac
gattgtaacgttgttttattggcgcgtggtgctgacgtcacacttttaaataaaaataac
gaatcgccattggattgtgtaccggctggtggagatacatacagtgtgattgcgttaaat
gtgacactcggtggcgcctacaatagtcaaaatgtcgttttgtgcaatgatattaccaaa
ggacgggaaagtaacccgattcagtgttacaatagtgttgacaatgccaccaaccctaat
gattttaagtacgtgactaaaaattgtataacgtcagatgacgtgaaaatcgaggcgaaa
atcacagatttacagtgttgccaatgtgaggaacgttgtgtcactgatgattgtcaatgt
ggtaaattatcgttgcgttgttggtacgatgaggaaggtaaattgattcccgaatttaat
tttggcgatattccaatgattttcgaatgtaacgacagatgtcagtgtaacgcaatcacg
tgtaataatcgagtcgtccaaaaagggcccaatcaaagatttgaattgtttaaaacactt
gataaagggtggggcatacgtacgctccgccccatatcacgtggtagcttcatatgtgaa
tacattggtgagattatcacggattctgaagctgataagcgtgaagatgacagtttttta
ttcgatttggagaatcgagtgtgcaagaatgaggacgtagattcctattgtatcgacgca
aaattctacggtaactttgcgcgttttatcaatcattcctgtaatcccaatttgacatct
gtcaaagtttttatcgatcatcaggatttgagatttccaaggattgctttttttgcaaat
cgggatatttcaaacgaggaggagttaagtttcgattatggagaaaagttttggttggcc
aaatataagttgttttcgtgcctttgtggcagtttggagtgcaagtattccgaggatacg
attggaatgaggacttaa

DBGET integrated database retrieval system