KEGG   Tribolium castaneum (red flour beetle): 664009Help
Entry
664009            CDS       T01046                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00500  Starch and sucrose metabolism
tca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    664009
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     664009
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 664009
NCBI-ProteinID: XP_969234
LinkDB All DBs
Position
LG2
AA seq 490 aa AA seqDB search
MHFKPILVLCLATLALGQKDPHFAADRNSIVHLFEWKWSDIADECERFLAPKGFGGVQIS
PPNENLVVTSSNRPWWERYQPVSYILNTRSGDEAALADMISRCNAVGVRIYVDTVINHMT
GMGGTGTAGSQADRDGKNYPAVPYGSGDFHDSCTVNNYQDASNVRNCELVGLADLNQGSD
YVRSKIIEYMNHLVDLGVAGFRVDAAKHMWPADLEAIYGSLKNLNTDHGFPDGQKPFIFQ
EVIDLGGEAISKHEYTGFGTVIEFQYGLSLGNAFQGGNQLANLANWGPEWNLLDGLDAVA
FIDNHDNQRTGGSQILTYKNPKPYKMAIAFMLAHPYGTTRLMSSFAFDNNDQGPPQDGAG
NLISPSINDDGTCGNGYVCEHRWRQIFNMVGFRNAVQETGIENWWSDGNQQIAFGRGNKG
FVAFTIGYDLNQHLQTGLPAGSYCDVISGNAENGSCSGKTITVGGDGYADISLGANEDDG
VIAIHVNAKL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcaaacccatcctcgtcctgtgtttagcaactttggctttgggccaaaaagac
ccacactttgccgctgacagaaactcaatcgtgcatttattcgaatggaaatggtcagac
atcgctgacgagtgcgagcgattcttggcaccgaaaggtttcggcggagttcaaatttcg
ccacctaacgaaaatttggtcgtaacaagcagtaacagaccatggtgggagaggtaccaa
ccggtgagttacatcctcaatacgcgatcaggggacgaagcggctttggctgatatgatc
agtcgatgcaatgccgttggagtcaggatttatgtagatactgtcatcaaccacatgact
ggaatgggcggtactgggaccgctggctcacaggcggaccgtgatgggaaaaattacccg
gcagtaccatatgggtctggagattttcacgactcttgcactgttaataattaccaagac
gccagcaatgtgcggaattgtgaacttgtgggacttgctgacttgaatcaaggttcggat
tacgtccgaagcaagattattgaatacatgaaccacttggtcgacctgggggttgcaggg
ttccgggtggatgcagcaaaacacatgtggccggccgacctagaggcaatttacggcagt
ttgaagaatttaaacaccgatcatggttttcccgacggccagaaaccgttcatcttccag
gaagtcatagatttgggtggtgaagcaatcagcaaacatgaatataccggcttcggtact
gtcatagaattccaatatgggctaagtctaggtaacgctttccaagggggcaaccaactg
gccaatttggccaattggggcccggagtggaacctgctcgatggtctcgacgccgttgct
ttcatcgacaaccacgacaaccaaagaacagggggctcccagatcctcacgtacaaaaac
ccaaaaccgtacaaaatggccattgctttcatgctagcgcacccatatggtaccacccga
ctgatgtcgagcttcgcctttgataacaacgaccaagggccgccgcaagacggtgctggt
aatttgataagcccgagtatcaatgacgatggtacttgtggtaatggttacgtgtgcgag
caccgatggcgccagattttcaacatggttgggttcagaaacgccgttcaagaaacggga
attgagaattggtggtcggatggtaaccagcaaatcgcctttgggagaggaaacaaagga
tttgttgccttcaccattgggtacgacctcaaccagcatttgcaaacaggactgccggct
gggtcgtactgtgatgtgataagtggtaacgcggaaaatgggtcttgttcggggaaaacc
atcacggttggaggagatggatatgccgatatttccctcggagctaatgaagatgacgga
gtgattgccattcatgttaatgccaaattgtaa

DBGET integrated database retrieval system