KEGG   Tribolium castaneum (red flour beetle): 664119
Entry
664119            CDS       T01046                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04013  MAPK signaling pathway - fly
tca04214  Apoptosis - fly
tca04215  Apoptosis - multiple species
tca04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    664119
   04391 Hippo signaling pathway - fly
    664119
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    664119
   04215 Apoptosis - multiple species
    664119
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 664119
NCBI-ProteinID: XP_975227
UniProt: D1ZZX5
LinkDB
Position
LG4
AA seq 245 aa
MEVRKSFKVMVSGYGSLLVISSLVCMSTASICVSRQYFNSRLASCVNCTECVEGDIVVRP
CEFHRDTLCRPIKELLKSIQPSNPHRHKHVHRGRHPGHEGTNNRSDGDLEITSTETPFSS
AETLVWDWQAIALSSAVFACFLFFLAITLYSLHQAKQWRRLKDTFDADVEELSAKLSLMA
ASSSEKGEILEPRIGPITDGNYLNNRCVYLEQLLNVRKDTKIGSEKGGNVYIEETSASPA
TSGKT
NT seq 738 nt   +upstreamnt  +downstreamnt
atggaggttcgaaagagtttcaaggtgatggtgtcagggtatggttccttgttggtgatc
tcaagcttggtgtgcatgagtacggcgtcgatttgcgtcagcagacaatacttcaactcg
agattagcgtcatgtgtgaattgtacagagtgcgtggaaggtgatattgtcgttcgtccg
tgcgaattccaccgcgatactctctgtcgccccatcaaagagctgctcaagtccatccag
ccgagcaacccccacagacacaaacacgtccacagaggcagacatccaggtcatgaaggc
accaacaatcgctctgatggagacttggaaatcaccagcacggagacaccgttttccagc
gccgagacgctcgtctgggattggcaagccatcgccctcagctcagcggtcttcgcttgc
tttctgttttttctagccatcacgctgtactcgctgcaccaggccaagcagtggaggcgg
ctcaaggatacgttcgacgccgatgtggaggagctttcggcgaagctgagtttaatggca
gcgtcgtctagcgaaaagggtgaaattctagagcctcggataggcccaatcaccgacgga
aactacctcaataacagatgtgtttatttagaacaactgctcaacgtgcggaaggacacc
aagattggatctgagaaaggaggcaacgtatatatcgaagaaacaagcgcttctccagcc
accagcggaaagacatag

DBGET integrated database retrieval system