KEGG   Thermofilum adornatus 1505: TCARB_0192Help
Entry
TCARB_0192        CDS       T03526                                 

Definition
(GenBank) putative inosose dehydrogenase
Organism
tcb  Thermofilum adornatus 1505
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AJB41268
UniProt: A0A3G1A5J9
LinkDB All DBs
Position
173870..175075
Genome map
AA seq 401 aa AA seqDB search
MTTMRAALVTAEFAPRPGYKISQDEIRTRKVREGAKVWKNPKLVLRTDYPVPEPKPDEIL
IRVKAVGICGSDIHFLETDNDGYIIYPGLTRFPVVIGHEFSGVVEKVGTNVKNYKPGDMV
TSEEMFWCGECDACRSVDFNHCIRLNDPADLEFGELGFTHDGAMADFVVVKAKYAWKIDS
LVDRYGSEEKAFEAGSLVEPTSVAYHAIFTRAGGFKPGAYVVVWGAGPIGLAAIALSKAG
GAGKIIAFEVSPERRELAKKVGADYVFNPVDLSKNGTEPWEKIMEITDGQGADVHIEAAG
APHRTVPHMQKSLAINGKIIQIGRAPQEVPIYLEVFQVRRGQIFGSQGHSGFGNFGNVIR
LMAAGRIDMTQIITSRFSLDDVYKAFERAHQRIDGKITIKP
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaatgagagctgctttagtaacagcagaatttgctccacgcccaggctacaaa
atatcacaggatgaaattcggacgagaaaggtaagggaaggtgcaaaagtatggaaaaat
ccaaaactcgtactgaggactgactacccagtcccagagccaaagccagacgagatactt
ataagagtaaaagctgtaggcatatgtgggagtgatatccacttcctcgagacagacaac
gatggctacattatttacccaggtctcacaagattcccggtagtcataggacatgaattc
agcggcgtagtagaaaaggtcgggacaaacgtgaaaaactacaagccaggagacatggtg
acaagcgaagaaatgttctggtgcggtgaatgcgacgcgtgcagaagcgtcgactttaac
cactgcatacggctaaatgacccggcagacctagaatttggtgaactcggcttcacccac
gacggcgcaatggctgactttgttgttgtaaaagcaaagtatgcatggaaaatagattct
ttagtagacaggtatggtagcgaagaaaaagccttcgaagccggaagcctggtagagcca
acaagcgtcgcctatcacgctatattcacgagagccggcggcttcaaaccaggagcatac
gttgttgtctggggagctgggccaataggcctagcagctattgctctttccaaggccggg
ggagccgggaaaattatagccttcgaggtcagcccagaaagacgtgaacttgcaaagaaa
gtcggagccgactacgtgtttaacccagttgacctctctaagaatggcacagagccatgg
gagaaaatcatggagataactgacgggcaaggagcagacgtccacatagaggccgcgggt
gcaccacaccgtacagttccccacatgcagaaaagcctggcaataaatggcaaaattatc
cagattggccgtgccccgcaagaagtgccaatttacctcgaagttttccaggtgagacgc
ggtcaaatatttggtagccaggggcacagcggcttcgggaacttcggcaacgtgataagg
cttatggccgctggcaggatagatatgacacagataattacttctcgattcagcctagac
gacgtctacaaggcttttgaacgtgcacaccagaggatagatggaaagataacgataaag
ccgtaa

DBGET integrated database retrieval system