KEGG   Thermofilum carboxyditrophus: TCARB_0543Help
Entry
TCARB_0543        CDS       T03526                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase, large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tcb  Thermofilum carboxyditrophus
Pathway
tcb00630  Glyoxylate and dicarboxylate metabolism
tcb01100  Metabolic pathways
tcb01120  Microbial metabolism in diverse environments
tcb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TCARB_0543
Enzymes [BR:tcb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     TCARB_0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AJB41603
LinkDB All DBs
Position
496724..498055
Genome map
AA seq 443 aa AA seqDB search
MPEEFEPYHTYVAKNYSPDLKQEVVVTFRVTPAEGFTIEDAAGGIAAESSVGTWTTLYEW
YDRNRLERLKGKAYFFESLGDGSYIVRVAYPVELFEEGNMPAFLASVAGNIFGMRRVKSL
RVEDIYMPEQFLKHFKGPNQGIQGVRERLKIYDRPIVGTVPKPKEGYTAEEVGKLAYEIL
VGGMDFIKDDENLASPSFCRFEARANAIMKAIDMAEKETGEKKTWLANITADVREMEKRL
KLIADLGNPHIMVDVVIAGWSALTYIRDLAEEHKLAIHGHRAFHAAFTRNPYHGISMFTL
AKLYRVIGIDQLHVGTPEVGKLEAKAIDVIRNARVLRDPVYRPDVEDSIHLAQPLTMFKP
AFPVASGGLHPGTLPAVIKAMGMDIVIQVGGGTLGHPDGPRAGAAAVRQAIEAYMTGVTL
EEYAKTHRELARALEKWGTVVPV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagagtttgagccctatcatacatatgtggctaagaattattctcctgaccta
aaacaggaagtcgttgtcacttttagagttactccagcggagggcttcacgatagaggat
gccgcgggcggcatagctgcagagagtagtgtaggcacgtggacaacgctatacgaatgg
tatgacagaaacaggctcgaaaggctcaagggcaaggcatacttctttgaaagccttgga
gacggctcctacattgtaagggtagcttacccggtagagctcttcgaggaaggtaacatg
cccgcttttcttgcatctgtcgctggaaacatctttggaatgagaagggtgaaatcccta
agggtcgaggacatatacatgcctgaacaattcctaaagcactttaagggtccgaatcag
ggtatccaaggtgtaagggaaagactaaaaatttatgataggcccatagtcggcacagtt
ccaaaaccaaaggaaggctacacagcagaagaagtggggaaactggcctacgagatactt
gtaggaggcatggacttcataaaggacgacgagaaccttgcgagcccgagcttctgcagg
ttcgaggcgagggcaaacgccataatgaaggcaatcgacatggcggaaaaggaaacaggc
gaaaaaaagacgtggctcgcaaacataactgcagacgtgcgggaaatggagaaaaggcta
aagctaatcgcagacctaggtaacccccacataatggtagacgtcgtcatagctgggtgg
tctgccttaacctatataagggaccttgcagaagaacacaaactggccatacacgggcac
cgagcattccacgcggcattcacgagaaacccgtaccacggcatatccatgttcaccctt
gcaaagctctatcgcgtaataggaatagaccagctacacgtaggcacaccggaagttgga
aagctagaggctaaagcaatagacgtcattaggaacgcaagagtactgcgagaccccgta
tacaggccagacgtcgaagacagcatccatctagcccagcccctgacaatgttcaagccc
gcattcccagtggccagcggtggactacaccccggaacgcttccagcagtgataaaggct
atgggcatggacatagtcatacaggtcgggggcggaacattgggccaccccgacgggcca
cgtgcaggtgcagcagctgtaagacaggcaatagaagcatacatgactggtgtaacccta
gaggaatacgctaagacccacagggagcttgcaagggccctagaaaagtggggcacagtt
gtccctgtctaa

DBGET integrated database retrieval system