KEGG   Thermofilum carboxyditrophus: TCARB_1446Help
Entry
TCARB_1446        CDS       T03526                                 

Definition
(GenBank) Tungsten-containing aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tcb  Thermofilum carboxyditrophus
Pathway
tcb00030  Pentose phosphate pathway
tcb01100  Metabolic pathways
tcb01120  Microbial metabolism in diverse environments
tcb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TCARB_1446
Enzymes [BR:tcb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TCARB_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AJB42492
LinkDB All DBs
Position
complement(1280117..1281967)
Genome map
AA seq 616 aa AA seqDB search
MKAGYVNRILTVNLSDNTIKEEPIDPQVAEKYIGGKGYALYVFYHRYLKEYMAKGISPKD
IDPLGPENVLAFTTGPITGIAGVPSPGRHHVMALKSPLTGSIASANSGGEFGAYMKFAGY
DMIFIEGAAEKPVYLEIVNGHVEIKDASDLWGRNVFDTTRILKSRVKGENVSVACIGPAG
ENLVLFANIMNDEHRAAGRTGIGAIMGSKKLKAIVVSGNQKPQIANPEGFRELSKNLIER
IRKNPVTGGGLPKYGTAVLVNIINQAGMLPYKNWQFGYNPEADKISGETLEKTYLIKRRP
CWGCQIGCGRVVKVPFGPYQIMYSEGPEYESIWALGNDTGVMDLAAVIKANHLCDELGLD
TISMGSTIATAMELYEKGYIPEEDLQGMDMKFGNAAALVEAVWRTAYKAGFGAKLALGSK
RLAEMYGAPELSMSVKGLEMPAYDPRGSKGIGLNYATANRGGCHVTGYTISPEILGLPQK
IDPLTPEGKAQWVKIFQDLTSVVNSAVNCLFATFEIGAKDYADLFNTIAGFNFTDSDVLK
IGERIYNLERYIMSLYGFGAKDDTLPPRLTKEPMPEGPVKGQVVELDKMLAEYYKLRGWV
DGVPTKEKLKELGIEL
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccggctacgtaaacaggattttaacggtaaacctttctgacaataccattaaa
gaggaaccaattgacccacaagtagcagaaaaatacattggcggcaagggctacgcccta
tacgtattctatcacagatacctcaaggagtacatggctaagggcatctctccaaaggac
attgacccgctaggaccagaaaacgttctagcctttacaacgggaccaataacgggcata
gccggagtcccatctccaggcagacaccacgtgatggccctcaagtctccactcacaggc
tctattgctagtgcaaactctggaggagaattcggcgcatacatgaagtttgcaggctac
gacatgatctttatcgagggcgctgcagagaaaccagtctatctagaaatagtcaatgga
cacgtagagataaaagatgcttctgacctctggggcagaaacgttttcgacactacacgt
atactgaagagcagggtcaaaggcgaaaacgtcagcgttgcatgtatcgggcctgcaggc
gaaaaccttgttctctttgcgaacatcatgaacgacgagcacagggcagctggcaggaca
ggaataggcgcaataatgggaagcaagaagttaaaagcaatagtcgtctcaggaaaccaa
aaaccacaaatcgctaatccagaagggttccgcgagctctcaaagaacctaatagagagg
atcaggaagaacccagttaccggaggaggactgccaaaatacggtacagccgttctagta
aacattatcaaccaggcggggatgctcccctacaagaactggcaattcggctacaaccca
gaagccgacaaaataagcggagagacacttgaaaagacatacctaataaaaaggaggcca
tgctggggctgccagatagggtgcgggagagtcgtgaaggttccatttggaccctaccag
ataatgtacagcgagggaccagagtacgagtccatctgggcgcttggcaatgatacagga
gtaatggatctagccgcagtcatcaaggcaaaccacctctgcgacgagctaggccttgac
acgatctctatgggtagtaccattgcgactgcgatggagctgtacgagaagggatacata
ccagaggaagacctacaaggcatggacatgaagtttggaaacgccgcggcacttgttgaa
gctgtttggcgcacggcctacaaggcaggcttcggcgcaaagctcgccctgggaagcaag
aggctagcagaaatgtacggtgcaccagaattatcaatgagcgtaaagggcctcgaaatg
ccagcatatgacccaagaggctcgaaaggcatagggctaaactatgcaaccgctaacagg
ggaggatgccacgtaacaggctacacaatctctcccgagatacttggactaccgcagaag
atcgacccattgacacctgaaggaaaagcccagtgggtcaaaatcttccaggatcttaca
agcgtagtcaactcggctgtaaactgtctcttcgcaaccttcgagataggagctaaagac
tatgcagacctcttcaacaccattgcaggctttaacttcactgacagcgatgtgttgaag
ataggtgaaaggatctataacctagaaaggtacataatgtccctctacggcttcggcgcc
aaagacgacaccttgcctccaagactcacaaaggagccgatgcccgagggacccgtcaaa
ggccaagtggtagagctcgacaagatgctagcggagtactacaagctgagaggctgggtc
gacggagttccaacaaaggagaagctcaaagagctaggcatagagctctaa

DBGET integrated database retrieval system