KEGG   Theobroma cacao (cacao): 18586480Help
Entry
18586480          CDS       T02994                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00564  Glycerophospholipid metabolism
tcc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    18586480
Enzymes [BR:tcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     18586480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 Pyr_redox GIDA Lycopene_cycl NAD_binding_8 HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 18586480
NCBI-ProteinID: XP_017984826
LinkDB All DBs
Position
10
AA seq 631 aa AA seqDB search
MSATATRLRRLAASTAAVAVTAAGGAILFTPISVNDRAGGASLESVRRKINDPSAVVPSR
TVQESALIGASATKPLDILVVGGGATGCGVALDAATRGLRVGLVEREDFSSGTSSRSTKL
IHGGVRYLEKAVFNLDYGQLKLVFHALEERKHFIENAPHLCHALPCMTPCFDWFEVVYYW
MGLKLYDLVAGPRLLHLSRYYSAQESVELFPTLARKGKDKSLRGTVVYYDGQMNDSRLNV
GLACTAALAGAAVLNHAEVVSFLKDEATKRIIGARIRDNLSGHEFETYAKVVVNAAGPFC
DSVRKMADKDAQPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGT
TDSNTSITPLPEPHEDEIQFILDAICDYLNVKVRRTDVLSAWSGIRPLAVDPKAKNTESI
SRDHVVSEDYPGLVTITGGKWTTYRSMAEDAVNEAIKSGKLSPSNECITRSLQLTGGDGW
EPSFFTVLSQQYVRMKKSYGGKVVPGVMDTAAAKHLSHAYGTLAEGVATIAQNETLGKRL
AHGYPYLEAEVAYCARNEYCESAVDFIARRSRLAFLDTDAAGRALPRIIQILATEHNWGK
SRQKQEMQKAKEFLETFKSSKNAQFHDGKHE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaaccgccactcgcctccgccgtctagctgcctccaccgctgcggtagcagtg
actgctgctggtggcgcaatcctctttactcctatatctgtcaatgaccgcgccggtggc
gcctctttagagtccgtcaggcggaagatcaatgatccgagcgccgtcgttccgtcgcga
actgtacaggaatcggctttgataggtgccagcgcgactaagccactcgacatcctagtt
gtcggcggcggtgccaccggctgcggcgttgcgctcgacgctgccactagaggcctccgc
gtcggcctcgttgaaagagaagatttctcctccggaacgtcttcgcggtccacgaagcta
attcatggaggtgtccgctacttggaaaaagctgtctttaaccttgactacgggcaacta
aagctggtttttcatgcacttgaggagcgtaaacattttatagagaatgctcctcatctc
tgccatgctttgccatgcatgacgccctgttttgactggtttgaggtagtatactactgg
atgggcttgaaattgtacgatttggtcgcaggaccacgtttgttacacttgtccagatat
tattctgcgcaagaatctgttgagctcttccctactcttgcaaggaagggtaaagataaa
agcttgaggggcacagttgtgtactatgatgggcagatgaatgactctcgcctaaatgtt
ggattagcttgcactgctgcgctagctggggcagcagtgcttaaccatgcagaagttgta
tcctttcttaaagatgaagctaccaagcggataattggtgcaagaattcgtgacaatttg
tcaggccatgagtttgagacatatgcaaaagttgttgtgaatgcggctggaccattttgt
gactctgtaaggaaaatggctgacaaagatgcacaacctatgatatgtcccagcagcggt
gtacatattgttctccctgattactattctccagaaggaatgggcttgattgtccctaaa
actaaggatggacgtgttgttttcatgctgccatggttggggagaactgtagctggcaca
acagattctaacacttccatcaccccacttcctgaaccacatgaggatgaaattcaattt
atacttgatgccatctgtgattaccttaatgtcaaggtgcgacgaactgatgttctttct
gcctggagtggtattcgtccattggcagtggatcctaaagcaaagaacactgagagcatc
tctagagatcatgtggtttctgaggattatcctggtttagtcacaattactggtggaaag
tggactacttaccgaagcatggcagaagatgcggttaatgaagctatcaagtctggtaaa
ctgagcccaagcaatgaatgtataacaagaagcctgcagctgactggtggagatggatgg
gaaccctcattttttactgttctttctcagcagtatgttcgcatgaagaagtcatatggt
ggtaaagttgttcctggggtgatggacacagccgctgcaaagcatttgtctcatgcatat
ggcacattggcagaaggagtagccaccatagctcagaatgaaactctgggtaagaggctt
gcacatgggtacccttatttggaggcagaggttgcatattgtgctcgtaatgagtactgt
gagtctgctgttgatttcattgcccggagatctcgccttgctttccttgacactgatgca
gcaggccgtgcgttgccacgcattatccaaatacttgctactgagcacaactggggcaag
tcaaggcagaagcaagaaatgcagaaggctaaagaatttttggaaactttcaagtcttca
aagaatgcacagttccatgatgggaagcacgagtag

DBGET integrated database retrieval system