KEGG   Theobroma cacao (cacao): 18587944Help
Entry
18587944          CDS       T02994                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00071  Fatty acid degradation
tcc00592  alpha-Linolenic acid metabolism
tcc01100  Metabolic pathways
tcc01110  Biosynthesis of secondary metabolites
tcc01212  Fatty acid metabolism
Module
tcc_M00087  beta-Oxidation
tcc_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    18587944
   00592 alpha-Linolenic acid metabolism
    18587944
Enzymes [BR:tcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     18587944
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     18587944
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     18587944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 18587944
NCBI-ProteinID: XP_017983130
LinkDB All DBs
Position
9
AA seq 716 aa AA seqDB search
MAGGEAHRVTMEVRGDGIAVIAFSSPPVNALHIPALTELKRMHSESMERDDVKAVVLTGA
GSKFCSGLDMSLVQDIQRTGDDSVLAEISHDLIDQVEDGKKPSVAAIQGYALGAGLELSM
GCCARVATPGAKLGLPELTLGFSPGLGGTQRLPRLVGVSKAAQMLLTSKPVMSEEGKSLG
LIDAIASPEELLEVACDLALDIVESRRPRLSSLSRTDKLGSTEQAMEILEGIRQGAKETA
HTMPEKLACLDVIGEGITSGGRSGVLKEMEVFRELVLSTAAKALVHVSCAQRATSQVRGV
TDAGLKPRPIGKVGVIGAGLMGSGITTALILSNIHVVLKELNSEYLQRGIKKIEANLQAL
VTKGKLDENGVKKALSFLRGVSDYSEFKDVDLVIEAVIEDLSLKQSIFEEIDKVCPPHCI
LASGTSGIDLNKIGERTSSQDRIVGAHFFSPAHIMPLLEIVRTEKTSTQVLLDLMTIGKA
IKKVPLIVGNCTGFAVNRTFSPYFQGPFLLADLGVDIFRIDRVVCSFGLSMGPYLLHDVT
GYGLAIAFAKEMAATFPDRTFQSALHGLMLQHGRQGKSNGKGYYIFEKGSKPKPDYTVQP
IVEESRRITNLVENPISISDQEIVEMIFFPVVNEGCRIIEEGVIARASELDVASVLGFNF
PSRLGGIMFWADTIGAKYIYTNLKKWSALYGPFFRPSRFLEERAMKGIPLGAPVEA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggccggcggcgaagctcaccgagtgaccatggaagttaggggtgatgggatcgctgtc
atcgccttctctagtccacctgttaatgcgttgcacatcccagcactgaccgagttgaag
aggatgcacagcgaatcaatggagagagatgacgtgaaagctgtcgttttgaccggtgct
ggcagcaaattttgtagtggcttggacatgagtctagtgcaagatattcagagaactggg
gacgactcggttctggctgaaatatctcatgatttaatcgatcaagttgaagatggcaaa
aaaccttctgttgctgcaattcaaggatatgcactgggagcgggcttggaactgtcaatg
ggatgctgtgcacgggttgccactccaggagctaaactgggtttgccagagcttacactt
ggattcagtccagggcttggaggcactcaacgtcttccaaggctcgtaggagtttcaaag
gctgcgcaaatgttgctgacttcgaagccagtaatgtcagaggaagggaaaagccttggg
cttattgatgccatagcttctcctgaagagttgttggaagtagcatgcgacttggctcta
gatattgtagaaagccgtagaccgcgcctttcctctctttcaagaaccgataaacttggt
tctaccgaacaagcaatggagatattagagggcattcggcagggggcgaaagagactgct
catactatgcctgagaaactggcctgtcttgatgtcattggagagggaattacttctgga
ggacgttctggcgttttaaaggaaatggaagtatttagagagttggtgctctcaaccgct
gcaaaagctcttgtccatgtctcctgtgcccaacgtgcaacatctcaggtgcgtggtgtg
actgatgctgggcttaaaccacggccaatagggaaagttggtgtaattggtgctggtctg
atgggttctgggatcaccactgctctcattttgagcaatatccatgtcgttcttaaggaa
ctcaattctgaataccttcagagagggattaaaaagattgaagctaatctccaagcctta
gttacgaaaggaaagttggatgagaatggggtcaagaaagctctttcatttctaagaggt
gtatcagattactcagaattcaaagatgtggatttggtaatagaggctgtgattgaagac
ctgtcactcaaacaatcaatttttgaagaaattgacaaggtttgtcctcctcactgcatc
ttggcatcaggcacatcaggcatcgatcttaataaaattggagagagaaccagctctcaa
gatcgcattgttggagctcattttttcagtcccgcacatataatgccactcttggagatt
gtccggacagagaaaacttcgacacaagttctgcttgatcttatgacaattgggaaggcc
attaagaaagttcctctcattgttggaaactgcaccggatttgctgtaaatcgtaccttc
tctccttattttcaaggaccatttctgttggcagacttaggtgtcgacattttcagaatt
gacagagtggtttgctcatttggcttgtcaatggggccttacctgcttcatgatgtaact
ggatatggcttggctattgcatttgccaaagagatggctgctaccttccctgacaggacg
ttccagtctgctttacatgggctcatgcttcaacatggccgacagggtaaaagcaatgga
aaaggctattacattttcgagaagggaagcaagccaaagcctgattacaccgtgcaacca
atagttgaggagtccaggagaattacaaacctggttgagaaccccatttccataagcgac
caagaaatcgtggagatgatattcttcccggtggtgaatgagggatgccgcattatagag
gagggagtgattgctcgggcatcagagcttgacgttgcatctgttcttgggttcaatttc
ccttcccgcctgggaggtataatgttctgggctgacacaatcggagcaaagtacatatac
acaaatctcaaaaagtggtcagctctgtacggccccttcttcagaccctcaagattcttg
gaagagagggccatgaaaggcatcccattgggtgcacctgttgaggcataa

DBGET integrated database retrieval system