KEGG   Theobroma cacao (cacao): 18588505Help
Entry
18588505          CDS       T02994                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00010  Glycolysis / Gluconeogenesis
tcc00051  Fructose and mannose metabolism
tcc00052  Galactose metabolism
tcc00500  Starch and sucrose metabolism
tcc00520  Amino sugar and nucleotide sugar metabolism
tcc01100  Metabolic pathways
tcc01110  Biosynthesis of secondary metabolites
tcc01200  Carbon metabolism
Module
tcc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tcc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18588505
   00051 Fructose and mannose metabolism
    18588505
   00052 Galactose metabolism
    18588505
   00500 Starch and sucrose metabolism
    18588505
   00520 Amino sugar and nucleotide sugar metabolism
    18588505
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    18588505
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tcc04131]
    18588505
Enzymes [BR:tcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     18588505
Membrane trafficking [BR:tcc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    18588505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF1731
Motif
Other DBs
NCBI-GeneID: 18588505
NCBI-ProteinID: XP_007013021
UniProt: A0A061GL96
LinkDB All DBs
Position
9
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALVVRHRIKSSGKWARTLAILKEFEEKCGTPISKLKQVAD
AMTVEMHAGLASEGGSKLKMIISYVDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKESR
VVKQEFEEVSIPPHLMTGSSDALFDYIASALAKFVATESEGLHVSPGRQRELGFTFSFPV
RQTSISSGTLIKWTKGFSIDDTVGQDVVGELTKAMERVGLDMRVAALVNDTIGTLAGGRY
NNPDVVAAVILGTGTNAAYVERAHAIPKWHGLLPKSGDMVINMEWGNFRSSHLPLTEYDQ
ELDADSLNPGEQIFEKMISGMYLGEIVRRVLYKMAEEAEFFGDTVPPKLKIPFILRTPHM
SAMHHDTSPDLKVVATKLKDILEISNTSLKMRKVIVELCDIVATRGARLSAAGIVGILKK
LGRDIVKDGEKLKSVVALDGGLYEHYTKFRTCMENTLTELLGDEVSDNIVIEHSNDGSGI
GATLLAACHSQYIEVEES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggcggtgggagcggctgtggtttgcgctgcggcggtgtgtgctgcggcg
gcactggtggtgcgtcacaggatcaagagttcggggaagtgggcccgtacgctggctatc
ctgaaagagttcgaggaaaaatgtgggaccccaatttcgaagctgaagcaggtggcggat
gctatgaccgttgagatgcacgcggggctcgcatcagagggtggcagcaagctcaagatg
atcatcagctacgtagataatctccccactggtgacgagaaagggttgttttatgccctt
gaccttggtggcacaaattttcgtgtcctacgtgtacagttgggtggtaaagaaagccgt
gttgttaagcaggaatttgaggaagtttcaattcctccgcatttgatgaccggatcttct
gatgcattatttgattatattgcttcagctcttgcaaaatttgttgctacagaaagtgaa
ggtttacatgtttcacctggtagacaaagggagctgggattcactttctcgtttcctgtt
aggcaaacatcaatatcatcagggactcttataaaatggacaaagggcttctcgatagat
gatacagttggacaagatgttgtgggtgagttgaccaaagccatggaaagggttggcctt
gacatgcgtgtggcagctttggttaatgatacaattgggacattggctggtggtagatac
aacaacccagatgttgttgctgctgtgatattgggtacaggcacaaatgcagcttatgta
gagcgtgcccacgcaattcccaaatggcatggtcttctacctaaatcaggagacatggtt
atcaacatggagtggggtaactttcggtcttcacaccttccactaacagaatatgaccaa
gaacttgatgctgacagtctaaaccctggagaacagatttttgaaaaaatgatttctggt
atgtatttgggagagattgtacgcagagttttgtacaagatggctgaagaagctgaattt
tttggtgatactgttccaccaaagttgaaaattcctttcatattaagaactcctcacatg
tctgcaatgcatcatgacacgtctcctgatctgaaagtggttgcaaccaaactaaaggat
atattagagatatctaatacctccctgaaaatgagaaaagttattgttgagctgtgcgac
attgttgctactcgtggtgcccgtctatctgctgccggaatcgttggcatcctcaagaaa
ctgggaagagacatagtgaaagatggtgaaaagctgaagtcagtggtagctctagatggt
ggattatatgagcactacactaaatttaggacctgcatggagaacaccctcacggagttg
ttaggagatgaagtctctgacaatattgtcattgagcactccaatgatggctctggcatt
ggggcaaccctcctggcagcctgtcactcccaatacattgaggttgaggaatcctga

DBGET integrated database retrieval system