KEGG   Theobroma cacao (cacao): 18589292Help
Entry
18589292          CDS       T02994                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00630  Glyoxylate and dicarboxylate metabolism
tcc00710  Carbon fixation in photosynthetic organisms
tcc01100  Metabolic pathways
tcc01200  Carbon metabolism
Module
tcc_M00165  Reductive pentose phosphate cycle (Calvin cycle)
tcc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
tcc_M00532  Photorespiration
tcc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    18589292
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    18589292
Enzymes [BR:tcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     18589292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small Swm2
Motif
Other DBs
NCBI-GeneID: 18589292
NCBI-ProteinID: XP_017982474
LinkDB All DBs
Position
9
AA seq 167 aa AA seqDB search
MSAGIFAAPVAGSSYVGLKTNVPKLLPAKDSIAWSRKTVSNGSRTHCMKTWNPFNNKKFE
TLSYLPPLSDDSIAKEIEYMMKKGWIPCLEFDEVGLVQRENSRIPGYYDGRYWTLWKLPM
FGCNNSSQVLNEIHECKKAYPNAYIRCLAFDSKHQAQCMSFVIQKPT
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccggaatctttgcagctccagttgccggttctagctatgtgggcttgaaaaca
aatgttccaaagctgctcccagctaaggattctattgcatggagccggaaaactgtctcc
aatggttcaagaactcattgcatgaagacatggaatccattcaataacaagaagtttgag
acgctctcttatcttccacctctctcagatgactcgattgcgaaggaaattgagtacatg
atgaagaagggctggatcccttgccttgaatttgatgaggtggggcttgtccaaagggag
aatagcagaattccagggtactatgatggaaggtattggacactttggaagctgccaatg
tttgggtgcaacaactcctctcaagtcctgaatgaaattcatgagtgcaaaaaggcatat
ccaaatgcttatatccgctgcctggcatttgacagcaagcatcaggctcagtgcatgtcc
tttgtcatccagaaacctacctaa

DBGET integrated database retrieval system