KEGG   Theobroma cacao (cacao): 18590466Help
Entry
18590466          CDS       T02994                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    18590466
Enzymes [BR:tcc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     18590466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 18590466
NCBI-ProteinID: XP_007016064
LinkDB All DBs
Position
9
AA seq 223 aa AA seqDB search
MQAAAIAAMAAHAILTVTTSHHTLLAPFPTNSSTPAVLQSSFRGVSLKLPCQSLSIAATV
PKKPLIVFAATKKAVAVLKGDSKVEGVVTLTQDDDGPTTVNVRITGLTPGPHGFHLHEFG
DTTNGCMSTGAHFNPNNMTHGAPEDKVRHAGDLGNIVANADGVAEATIVDKQIPLSGPNA
IIGRALVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPI
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctgcggctatagcagccatggcagcccacgctattctcacagtgaccacatct
caccacactctccttgctccgttcccaactaactcatcaaccccagcagttcttcaatcc
tcatttcgaggtgtctctctcaagctcccttgccaatccctttccattgctgccactgtt
cccaagaagccacttattgttttcgctgctaccaagaaagcagtggctgtccttaaaggt
gattccaaagttgaaggtgtcgtcacgttgacccaagatgatgatggtcctacaactgta
aatgttcgtattactggtcttactccagggcctcatgggttccacctacacgagtttggt
gacacaacaaatggatgcatgtcaacaggagcacatttcaatcctaacaacatgacacat
ggtgctcctgaggataaagtacgccatgcgggtgacctgggaaacatagttgctaatgct
gatggagtggcagaggcaacaattgtggacaagcagataccacttagtggccccaatgca
atcattggaagagcacttgtggttcatgagcttgaggatgatcttggaaagggtggacat
gaacttagtctaaccactggcaacgcaggtggaagattggcatgtggtgtcgtcggcttg
actccaatataa

DBGET integrated database retrieval system