KEGG   Theobroma cacao (cacao): 18590967Help
Entry
18590967          CDS       T02994                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc03030  DNA replication
tcc03410  Base excision repair
tcc03420  Nucleotide excision repair
tcc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    18590967
   03410 Base excision repair
    18590967
   03420 Nucleotide excision repair
    18590967
   03430 Mismatch repair
    18590967
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tcc03032]
    18590967
   03400 DNA repair and recombination proteins [BR:tcc03400]
    18590967
Enzymes [BR:tcc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     18590967
    6.5.1.6  DNA ligase (ATP or NAD+)
     18590967
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     18590967
DNA replication proteins [BR:tcc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    18590967
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     18590967
DNA repair and recombination proteins [BR:tcc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     18590967
   NER (nucleotide excision repair)
    Other NER factors
     18590967
   MMR (mismatch exicision repair)
    Other MMR factors
     18590967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-GeneID: 18590967
NCBI-ProteinID: XP_007016876
LinkDB All DBs
Position
9
AA seq 800 aa AA seqDB search
MLTFRPCHLLRHTCLSRPLNLRFPPSSSHFLPSKPSFFRPPPLFLSPLNPYSNMSSRPSA
FDALMSNARRLAAKKNSSSSSPTKKRKSLDSSPSKTQSPNSTKTQDSTEVKPDQESDING
IEKPIEDSPKANADETQKPPDSKKMKVVSVSERNAELKGKIGSLKKKPADFDPKMVACWE
KGERVPFLFLSLSFDLISNETGRIVITDIVCNMLRTVIDTTPDDLVAAVYLAANKVAPAH
EGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVV
KVFDTFRLIAKESGKDSQEKKKNRIKALLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAA
LGQAAVYNEQHSKPPPNIQSPLEEAAKIVKQVFSILPVYDKVVPALLTGGIWNLSKTCSF
TLGVPVGPMLAKPTKGVAEIVNKFQDIDFICEYKYDGERAQIHYMENGIVEIYSRNAERN
TGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILSTRARKNVVVSDIKVD
VCIFAFDILYLNGQPLLQEQLKVRKERLYDSFEEEAGFYQFATALTSNELEEIQAFLDSA
VSLSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGF
YGAFLLACYDDRNEEFQSICKIGTGFTESELEERSASLRSKVIPEPKSYYRYGEMMKPDV
WFEATEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKAPEQASSSEQVA
EMYNAQKHNQANNEDDGDDD
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgtttcgtccatgccatctgcttcgccatacttgtctttctcgacctctcaac
cttcgctttcctccatcttcctcccatttcctcccctctaaaccctctttctttcgccct
ccacccctctttctttcccccttaaacccttactccaacatgtcttctcgtccctccgcc
ttcgatgctctcatgtccaacgctcgccgtttagcggcaaagaaaaacagttcctcttct
tcacccaccaagaaacgcaaatccctcgattcatcgccatcgaagacccaaagccctaat
tcgaccaaaacccaggattctaccgaggtcaagcccgaccaagaaagcgatattaatgga
attgaaaagcccattgaagattccccaaaagccaatgcagatgagacgcagaaacctccc
gattcgaagaaaatgaaggtggtgagtgtgtcggagagaaatgcggaattgaaggggaaa
attgggtcactgaagaagaagccggcggattttgacccgaaaatggtggcgtgttgggag
aaaggagagagggtgccatttttgtttctttctttgtcgtttgatttgatatccaacgag
acgggtcggattgtgataacggatattgtttgtaatatgttgaggactgttattgatacg
acaccggatgatttggtggcggcggtttacttggcagcaaataaggttgctccggcgcac
gagggattagagctgggaattggggatgcctcgattatcaaggccctcgcggaggcctgt
gggaggactgaatcacaggttaagagtcagtacaaggataagggagacctgggccttgtt
gcacaagctagccgttcatctcaatcgatgatgcgcaagcctgatccattaactgttgtc
aaagtgtttgacacctttcgtctaattgctaaggaatctggaaaggatagtcaggagaag
aaaaagaatcgtatcaaggcacttcttgttgctgcaactgactgtgaacctcaatatttg
attcgtctacttcagacaaagttgcggattggattttcagagcagactctattagctgca
ttaggacaagctgctgtatataatgaacaacattctaaaccacctcctaacattcagtct
cctttagaagaggctgctaagattgtaaaacaagttttttccatccttccagtctatgat
aaagtagtgcctgctcttctgactggtggtatatggaatctttcaaagacttgtagcttt
acactgggtgtccctgtgggacctatgctagcaaaaccaaccaaaggggttgcagaaatt
gtaaataaattccaggatattgactttatatgtgaatataaatatgatggagaacgtgca
cagatacattatatggagaatggtatagttgagatatacagtcgaaatgctgagcggaac
actggaaagtttccagacgttgtagctgccatttctagattcaagaagtcctctgtaaaa
tcatttgttttggattgtgaacttgttgcttatgatcgggttcaaaagaaaattttaccc
tttcagatccttagtacaagagctcgcaaaaatgtggtagtgagtgacatcaaagttgat
gtgtgcatatttgcttttgacatcttgtatcttaatgggcaaccacttcttcaggaacaa
ctgaaagttcgtaaggagaggctttatgactcatttgaagaagaggctgggttttatcag
tttgcaacagccttaacatcaaatgaacttgaggaaatacaagcatttcttgattctgct
gtttctttaagttgtgagggcttaattatcaaaacattggatagagatgctacatatgag
ccatcaaagcggtcactcaactggctaaaattgaagaaagactacatggaaagtattgga
gacacattagatctagttcctattgctgctttccatggccgtgggaaacggactggcttc
tatggtgcatttctcttggcatgttatgatgacaggaatgaagaattccagagtatctgt
aaaataggcacgggatttactgaatcagagcttgaagaacgttctgccagtctccgctct
aaagtgattcctgaaccaaagtcatactatcgttatggagagatgatgaaaccagatgta
tggtttgaggctactgaggtttgggaggtaaaagctgcagacttgaccattagccctgtt
catcgtgcagcaattgggattgtggatcctgataagggcatatctctccgatttcctcgt
ttagttcgtgttcgagaagataaggctccagagcaagcttcatcatctgagcaggttgct
gagatgtacaatgctcaaaaacacaatcaagctaacaatgaagatgacggtgatgatgat
tga

DBGET integrated database retrieval system