KEGG   Theobroma cacao (cacao): 18591198Help
Entry
18591198          CDS       T02994                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00500  Starch and sucrose metabolism
tcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    18591198
Enzymes [BR:tcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     18591198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70 Nod_GRP
Motif
Other DBs
NCBI-GeneID: 18591198
NCBI-ProteinID: XP_017981207
LinkDB All DBs
Position
8
AA seq 415 aa AA seqDB search
MLTSLCFISLFLSVFPSLVSPALLFQGFNWESCNKAGGWYNFLKNSVSDIANAGVTHVWL
PPPSQSVGPQGYLPGRLYDLDASKYGSQAELKSLIDAFHQKGVKCVADIVINHRTAERKD
GRGIYCIFEGGTPDDRLDWGPSFICGDDKEYSDGTGNPDTGLGYQPAPDIDHLNPRVQKE
LSDWMNWLKTEIGFDGWRFDFVRGYAPSITKIYMDQTSPDFAVGEKWENFSLGQEDSHRG
ALKDWVEAAGGVVTAFDFTTKGVLNAAVQGELWRLKDSNGKPPGMIGLLPQNAATFVDNH
DTGSTQNQWPFPSDKVMQGYAYILTHPGVPSIFYDHFFDWGLKDEISKLVAIRNRNGIST
SSTVNILASDSDLYMASIDEKIIMKIGPKMDLGNLVPSNYQLATSGNDYAVWEKK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgttgacttcactttgcttcatctctctcttcctctctgtctttccctctttggtatcc
cctgccttactgttccagggtttcaactgggaatcatgcaacaaggcaggtggatggtac
aactttctcaagaactccgtctctgatattgctaacgctggtgttacacatgtttggctc
cctccaccatcgcagtccgttgggccccagggatacctgccaggaaggctgtatgatctt
gacgcatcaaagtatggatctcaggcagaattgaagtcattgattgatgctttccatcaa
aaaggagtcaagtgtgttgctgacatagtaataaaccatagaacagctgagaggaaagat
ggaagaggtatatattgtatttttgaaggtggaaccccagatgaccgtttagattggggg
ccatccttcatttgtggcgatgataaggagtattcggatggcacaggcaatcctgacact
ggactgggttaccagcctgctcctgacattgatcatctcaatccaagggtacaaaaggaa
ttatcggattggatgaattggttaaagactgaaattggatttgatggatggcgttttgat
tttgtaagaggctatgccccaagcattaccaaaatctacatggatcaaacttcaccagat
ttcgctgttggggagaaatgggaaaacttttctcttggacaagaagattcacatcgcggt
gcactaaaagattgggttgaagcggccggtggggttgttacagcatttgatttcactaca
aaaggggttctcaatgctgccgtgcaaggggagttatggcggttgaaggactcgaatggt
aaacctccaggaatgattggacttttacctcaaaatgctgctactttcgtcgacaatcat
gacaccggttccacccaaaatcaatggcccttcccatctgacaaagtcatgcagggatat
gcttatattctcacccatcctggcgtcccctccattttttacgatcacttctttgattgg
ggtttgaaggatgagattagtaaactggtggcgatcaggaacaggaatgggatcagtacc
tcaagcacggttaatattctggcttctgattccgacctttacatggcatctattgatgag
aaaattattatgaagattggaccaaagatggatcttggaaaccttgttccttctaactac
cagcttgctacctcagggaacgactatgcagtatgggagaagaagtga

DBGET integrated database retrieval system