KEGG   Theobroma cacao (cacao): 18595546Help
Entry
18595546          CDS       T02994                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00052  Galactose metabolism
tcc00500  Starch and sucrose metabolism
tcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    18595546
   00500 Starch and sucrose metabolism
    18595546
Enzymes [BR:tcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     18595546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 18595546
NCBI-ProteinID: XP_007023616
LinkDB All DBs
Position
6
AA seq 893 aa AA seqDB search
MDKKRGRKAKSSVNSLFHLLISFSCLVHGKVEEVVGYGYAIQSVGVDQSGKLLKADLRLI
KNSTIFGPDIQNLNLIASFDAGERLRIRITDSDDERWEVPQEIIPRRHGSFPQNHSSSLE
RRVLTHPSSNLIFTLYNTTPFGFAVSRRFSGDILFDTSPDASDSGTFLVFKDQYIQLSSS
LPKNRSSLYGLGEHTKSSFKLRTNDTLTLWNADIGSANPDVNLYGSHPFYLDVRLGSEDG
RVRTGSSHGVLLLNSNGMDIIYGGDRITYKIIGGIIDLFIFEGPSPEMVVQQYTGLIGRP
APMPYWSFGFHQCRWGYKNVSDIEGVVAGYAKAGIPLEVMWTDIDYMDGFKDFTLDPINF
PQEHMKNFVDTLHQNGQKYVLILDPGISVNKSYATYIRGMQADIFIKRDGIPYLGQVWPG
SVYFPDFVNPEGRAFWGNEIKLFQDLLPFDGLWLDMNEISNFITSPPTPSSTFDSPPYLI
NNAGIRRPINNLTVPATSLHFGNITVYNAHNLYGLLEAKATNAALINMTGKRPFILSRST
FVGSGKYTAHWTGDNAATWDDLAYSIPSILSFGIFGIPMVGADICGFSGNTTEELCRRWI
QLGAFYPFARDHSALNTRRQELYLWESVAATAKKVLGLRYQLLPHMYTLMYEAHTKGIPI
ARPLFFSFPQDINTYEISSQFLIGNGILVSPVLKPGAVSVDAYFPAGNWFDLFNHNISII
VENGEYIMLDAPPDHINVHVREGSILVLQGEALTTKEARSMPFHLLVVASSKENSSGQVF
LDDGEEVEMGGESRNWSLVKFHAVVVGDKLTIRSSVVNGEFAVSRNWTIDKLTFIGLEKV
NGIKGYELPTNKNGNIYVTTSFHSNGDQFGIAEMSDLSLLVGEEFQLELKLNN
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaaaagggggagaaaagcaaagtcgtctgtaaattctctcttccatcttctc
atctctttttcttgcctcgttcatgggaaagtagaagaagtagtggggtatggatatgca
attcaatcagttggagttgatcagtctggcaagctcttgaaagctgatctccgtctaatc
aagaactccaccatttttggacctgacattcaaaatctcaaccttattgcgagctttgac
gcaggggagcgtttgagaattcgaataacagactcagacgatgaaagatgggaagttcct
caagaaatcatccctcgtcgtcatggctcttttccacaaaaccattccagttccttggaa
agacgagttctcactcacccttcctccaacctcatttttaccctctacaacaccacccca
tttggcttcgctgtctctcgccgtttctccggcgacatcctctttgacacgtccccggat
gcatcagattcaggcacatttcttgtcttcaaggaccaatatattcaactatcctcttca
ctccctaaaaacaggtcttctttgtatggccttggtgagcatacgaaaagctcatttaag
ttgagaaccaatgatacgttgacattgtggaatgctgacattggtagtgcaaatcccgat
gtgaatctctacggttctcatccattttatctggatgtgagattggggtcggaggatggc
agagttagaacagggtcaagtcatggagttttgttgcttaacagtaatggtatggatata
atatacggtggtgataggataacttacaagatcattggtggaatcatagatttgtttatt
ttcgaggggccttcaccagagatggtggtacagcagtacaccggcctcattggccgacct
gcacctatgccatattggtcatttggctttcaccaatgccggtggggttacaagaatgtt
tctgatattgaaggggtagtcgctggctatgcaaaagctggtatccctctagaggttatg
tggaccgatatagactacatggatggatttaaggattttactcttgatcctatcaacttt
cctcaggaacatatgaagaactttgttgacacacttcaccaaaatggtcagaaatatgta
ctcatcttggatccaggtattagtgtgaataagtcatatgcaacttatataagagggatg
caggctgatatatttataaaacgtgacggtatcccttaccttggtcaggtttggcctgga
tcagtatactttcctgattttgtaaatcctgaaggcagagcattttggggtaatgagatc
aaattatttcaagatcttctcccatttgatggtctctggcttgacatgaatgagatatca
aattttataacttcccctcctactccatcttcaacctttgatagccctccttacctgata
aataatgctggaatcaggcgaccaatcaataacttaactgtgccagcaacttctctacat
tttggtaacattacggtgtacaatgcccataacctttatggcctattagaagccaaagcg
acaaatgctgctttaatcaatatgactggaaaaaggccatttatactctccagatcaacc
tttgtgggctctggaaagtacacagctcattggactggtgataatgctgctacctgggat
gatttggcatactctattccatcaattctcagtttcggaatattcggaatcccaatggtt
ggagccgatatatgtggtttttctggaaacacaactgaagagctttgtagacgttggatt
cagctaggtgccttttacccctttgcgcgagaccactcagcattaaacacaagacgtcag
gagctttatctctgggaatcagttgctgcaacagccaagaaggtgctaggcctccgctac
cagctacttccccacatgtacacattaatgtatgaggcacacacaaaaggaatccccatt
gcacgacccctttttttctcttttcctcaagacataaatacgtatgaaatcagctcacag
tttttgattggaaacggtatattggtgtcacctgttttgaagcccggagcagtttctgtt
gatgcatacttcccagcaggaaattggtttgacctctttaaccacaatatctctatcatt
gtagaaaacggagagtacattatgcttgatgcaccgcctgatcatataaatgtacatgtt
cgagaagggagtatcttggtgctgcaaggagaagccctgacgacaaaagaagctcgaagc
atgccatttcacctcctagttgtggctagtagcaaggaaaacagcagtggacaagtattt
ttagatgacggagaagaagtggagatgggtggagaaagcagaaattggagtttggtgaaa
tttcatgctgtagttgttggagacaaactaacgatcagatcaagcgttgtgaatggtgaa
tttgcagtcagtcggaactggactatagacaagttgacatttataggtctagaaaaggtt
aatggaattaaagggtatgagttgcccactaacaagaatggaaatatatatgtaacaaca
agctttcatagcaatggagaccagtttggcattgcagagatgtcagacttgtctttgctt
gttggagaagagtttcagttagagttgaagcttaacaactag

DBGET integrated database retrieval system