KEGG   Theobroma cacao (cacao): 18601965Help
Entry
18601965          CDS       T02994                                 

Definition
(RefSeq) DNA ligase 6
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc03030  DNA replication
tcc03410  Base excision repair
tcc03420  Nucleotide excision repair
tcc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    18601965
   03410 Base excision repair
    18601965
   03420 Nucleotide excision repair
    18601965
   03430 Mismatch repair
    18601965
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tcc03032]
    18601965
   03400 DNA repair and recombination proteins [BR:tcc03400]
    18601965
Enzymes [BR:tcc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     18601965
    6.5.1.6  DNA ligase (ATP or NAD+)
     18601965
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     18601965
DNA replication proteins [BR:tcc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    18601965
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     18601965
DNA repair and recombination proteins [BR:tcc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     18601965
   NER (nucleotide excision repair)
    Other NER factors
     18601965
   MMR (mismatch excision repair)
    Other MMR factors
     18601965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C UBA_4 RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 18601965
NCBI-ProteinID: XP_007033136
LinkDB All DBs
Position
4
AA seq 1404 aa AA seqDB search
MSSQAAATATAKILTVDSTELYLAALNSPDSTLSFPPIPSSFPPSKLIPNSRFLIDSFRH
PSTTFSAAYFLSHFHSDHYSGLSPTWSRGIIFCSHLTSLLLIQTLKIPPHFIFPLPLNDP
VVIDGCEVILIDANHCPGAVQFLFKVPTKNGSFERYVHTGDFRYCNSMKLNSYLNGFVGC
DAIFLDTTYCDPKFVFPSQEESIDYVVSVVDGIGKEFEKKRVLFLVATYVVGKEKILVEV
ARRCQRKICVDGWKMGILGVLGYGDDGVFTEDESESNVHVVGWNVLGETWPYFRPNFVRM
KEIMVEKGYEKVVGFVPTGWTYEVKRNKFAVRSKDSFEVHLVPYSEHSNYDELREYVKFL
KPKKVIPTVGMDIEKLDSKHADKMRKHFAGLVDEMANKKDFLMGFHHGNGENMEKVEVDA
SAGLNEEQDLEIKQNILEMDTVESNDVDITLNDPSSLHKPDSQDLTIPSEEERERIIEEF
RDCLPKWVTRDQILDLIGSSRWNIVEAVSTFCEREIELYEQVAVCRTSDSASQATSSNNS
MSLSNSGPFRSCTHESVSFHVSQTSKSRSLKLSVRSNISPGKRKKNTENKLNKKVKGNSK
LESSASKQPTITSFFGKLLADDTKGDRSGVKIEECSKGENFFPNNLTKSYVEKIDQFIHI
VNANESSRNYVATLLEKTQGDVNKALDIYYSKPQVNHGENTENFVPSSTSTEVPSCSNDY
SVTKKKNVPEESRCLADSSLQRQPMANVETTLVSLPSDKYKPIDHACWKSGQPAPYIHLA
RTFDLVGGQKGKIKAISMLCNMFRSLLALSPEDVLPAVYLCTNKIAADHENIELNIGGSL
VTSALEEACGTNRSKIRDMYNEIGDLGDVAQACRQTQTLLAPPPPLLIRDVYAVLRKISV
QTGSGSTIRKKNLIVNLMRSCREKEMKFLVRTLVRNLRIGAMMKTILPALAQAVFMNSSL
NLYHEGSADSLKEKLQDISAAVIEVYNVLPNLDLIVPSLMKEGIAFSSSTLSMVPGIPIK
PMLAKITNGVPEVLKLFQNKAFTCEYKYDGQRAQIHKLADGSVRVFSRNGDETTLRFPDL
INTIKESSKPAAQTFILDAEVVAIDRKNGYKLMSFQELSSRERGSKDSLITVNTIKVDIC
VFVFDIMFANGEQLLGFPLRQRRKCLKDLFYDEKLGHFEYAKEIAVEANDACLTSEPTLT
RINAFLDDALHFSCEGIMVKSLDTDAGYFPSKRGDTWLKVKRDYVEGLNDSLDLVPIGAW
HGNGRKAGWYSPFLMACYNPDTEDFQSVCRVMSGFSDSFYKEMKEFFSGDRILAKKPTYY
QTAEVPDMWFSPALVWEIRGADFTVSPVHQAAIGLVHPSRGISIRFPRYICSVSDRNPEE
CSTAADIAEMFHSQTRKMDVIVEH
NT seq 4215 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctcaagccgccgcgaccgccaccgccaaaatcctaaccgtagactccaccgaa
ctctacctcgctgccctaaactcccccgattccaccctctctttccccccaattccctcc
tcttttcctccctccaaactcattcccaactcccgcttcctcatcgactccttccgccac
ccctccaccaccttctccgccgcctacttcctctcccacttccactccgaccactactcc
ggcctctcccctacctggtccagaggtatcatcttttgttcccacctcacttccctgctc
ctcatccaaacccttaaaatcccaccccatttcatcttccccttacctttaaacgacccc
gttgtaatagatggctgcgaggtcattctcattgacgccaatcattgccctggggcggtc
cagttcttattcaaagttcccactaaaaatgggagctttgaaaggtacgttcatacgggc
gattttcgttattgtaattcaatgaagttgaatagttatttgaatggatttgttggttgt
gatgctatttttcttgatactacttattgtgatccaaaattcgtatttccttctcaagaa
gaatcgattgattatgtggttagtgtggtagatggtataggaaaggaatttgagaaaaag
agggttttgtttcttgttgctacttatgttgttgggaaagagaagattttggttgaggtt
gcacggagatgtcagaggaagatatgcgtggatgggtggaaaatgggcattttgggcgtt
ttagggtatggggatgatggggtttttacagaagatgaaagtgagagtaatgttcatgtg
gttggttggaatgtgttgggtgagacttggccgtattttcggccaaattttgtgagaatg
aaggagattatggtggaaaagggttatgaaaaagttgttggttttgtgccaactgggtgg
acttatgaagtcaaaaggaataaatttgcagtgaggtctaaggattcatttgaggtacat
ctagtcccatatagtgagcattctaattatgatgagcttagagaatatgtgaagttttta
aaaccaaagaaggttattcctacagtcggtatggacatagagaagcttgacagtaagcat
gctgataaaatgagaaagcactttgctgggttggttgatgaaatggccaataagaaggac
ttcctgatgggttttcatcatggcaatggtgaaaatatggaaaaagttgaagtggatgct
agtgctggcttgaatgaggagcaggacctggagataaagcaaaatatactggaaatggac
acagttgagagtaatgatgtggatattactttgaatgatccatcttcattgcacaaacct
gattcacaagatctaaccataccaagtgaggaggaaagagagagaatcattgaggaattt
cgggattgtttgcccaaatgggtcaccagggaccagatattagatttgattggcagctca
agatggaacattgttgaagcagtttccactttttgtgaacgtgaaattgagttgtatgag
caagttgctgtttgtagaacttctgattctgcatcccaagccacttcatctaacaactcc
atgtcgctttcaaattcaggaccttttagaagttgcactcatgaaagtgttagctttcat
gtaagtcaaaccagcaagtctcgtagcttgaaactttcagttaggagcaacatatctcct
ggaaaaaggaagaaaaacacagagaacaagttgaacaagaaagtaaaaggtaattcaaaa
ttggaatctagtgcgtcaaagcaacctacaataacaagcttcttcggtaaacttttggct
gatgacactaaaggtgataggagtggtgtaaaaattgaggaatgttctaaaggtgaaaac
ttctttcctaataatttgactaaatcatatgtagagaaaatagatcagtttattcatata
gtaaatgccaatgagtcatcaagaaattacgtggccaccttacttgagaaaacccaagga
gatgtcaacaaggcgctggatatatattatagtaagcctcaggtgaatcatggtgagaat
acagaaaatttcgtaccctccagcacatcaactgaggtcccgagctgttctaatgattat
tctgtcaccaagaagaaaaatgtgccagaggagtcaagatgtttggcggattcttctttg
caaagacaaccaatggcaaacgtggagacaactcttgtatcactgccttctgataaatat
aaacccatagaccatgcatgctggaagtctggtcagcctgctccatacatccatcttgca
cggacttttgacctggttgggggtcaaaagggcaagatcaaagctatatctatgctttgc
aatatgtttagaagtttgctggccttgtccccagaggacgtgcttcctgctgtgtatctg
tgcaccaataaaattgctgctgaccatgaaaatattgaattaaatattggcggaagcttg
gttacatctgcactggaagaagcttgtgggactaaccgctcaaaaataagggatatgtac
aatgaaattggtgatcttggtgatgttgcacaagcatgccggcaaactcaaactttactt
gctcctccaccaccattattaattagggatgtatatgctgtgctccggaagataagtgta
caaacaggcagtggcagtaccatccgaaagaaaaacctcattgtgaatcttatgcgttca
tgtcgagagaaggagatgaagtttctagttagaactttggtcaggaatttgcgaattgga
gcaatgatgaaaaccattctgcctgcattagctcaagcagttttcatgaattcctctctt
aatctttatcatgaagggtcagcagatagtctaaaagagaagcttcaggacatttctgca
gcagtaattgaggtatataatgtacttccaaatttggacttgattgttccttcactaatg
aaggaaggtattgcattttcatcatcaaccttgtcgatggttccaggaatacctattaaa
ccaatgcttgcgaaaattactaacggggttccagaagtactgaagctctttcaaaacaaa
gcttttacatgtgaatataaatatgatggtcagcgtgcccaaattcacaaattggcagat
ggatcagtgcgtgtcttttcacgaaatggggatgaaacaacattaagatttccagattta
attaatacaattaaggagtcttctaagcctgctgcccagactttcatattggatgctgag
gttgttgcaattgataggaagaatggttacaagctcatgtccttccaagaattatcttca
agagaaagagggagcaaagattctttgatcacagtgaacactataaaggttgacatttgc
gtatttgtgtttgacatcatgtttgctaatggagagcagttgttaggttttcctctacgt
caaagaaggaaatgtttgaaggatttgttttacgatgagaagttgggtcactttgaatat
gcaaaagaaattgcagtggaagccaatgatgcttgtttgaccagtgagcccacattgact
aggataaacgctttccttgatgatgcactgcacttctcatgtgaaggaattatggttaaa
tccttagatactgatgctggatattttccatccaagcgtggtgacacatggttaaaggtg
aagcgagattatgtggaaggattaaatgattcccttgatttagtccctattggtgcttgg
catggtaatgggagaaaagcaggatggtacagtccgttcctcatggcatgttacaaccca
gacacagaagattttcaaagtgtgtgccgtgtaatgtctgggttctccgattcattttac
aaagagatgaaagaattcttttctggagataggatcttagccaaaaagccaacttactat
caaacagctgaggtgcctgatatgtggttctccccagcacttgtttgggaaataagaggt
gcagacttcactgtgtcaccagttcatcaggctgctataggtttagtccatccatcccgg
ggcatctcaataagatttccaaggtacatttgctctgtgtcagatcgaaatcctgaggaa
tgtagcacagctgcagatatagccgaaatgtttcattcccagactcgaaagatggatgtg
atagttgaacactga

DBGET integrated database retrieval system