KEGG   Theobroma cacao (cacao): 18603340Help
Entry
18603340          CDS       T02994                                 

Definition
(RefSeq) histone-lysine N-methyltransferase family member SUVH9
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    18603340
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tcc03036]
    18603340
Enzymes [BR:tcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     18603340
Chromosome and associated proteins [BR:tcc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     18603340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 18603340
NCBI-ProteinID: XP_007035308
LinkDB All DBs
Position
4
AA seq 688 aa AA seqDB search
MGSLVPFQDLNLSPEPPQTISVDTPPSVTSTSTITFLTPKIEPKQEPFDEPAPTQTNYRQ
INTLFSPSSSAPEFPSNLESTPLSNISSSTDDQNALYSEYFRISELFRSAFAKRLQKYGD
IDVLDPDSRAIVPLPEEQREPTSETSPINTSNPDRALSVVGSRRRAGRSNELVRVTNLGI
EDERHFRDVVRRTRMMYDSLRILAILEEEKRKGPGHGRRARGDLRAAALMRERGLWLNRD
KRIVGSIPGIEIGDLFFFRMELCVMGLHGQAQAGIDYLPASQSSNGEPIATSIIVSGGYE
DDQDAGDLIIYTGHGGQDKLSRQCMHQKLEGGNLALERSMHYGIEVRVIRGIKYENSVSS
KVYVYDGLYKILDCWFDVGKSGFGVYKYRLLRIDGQPEMGSSIMRFAESLRTRPLSARPM
GYLSLDISMKKEKVPVFLYNDIDSDHDPMYYDYLVKTVFPPYAFGQGSNRTGCECVSGCT
EGCFCAMKNGGDFGYDHNGLLLRGKPVIFECGNFCQCPPTCRNRVSQHGLRNRLEIFRSR
ETGWGVRSLDLIQAGAFICEYAGVVLTREQAQVFTMNGDTLIYPNRFSERWAEWGDLSQI
FAEYVRPSYPSIPPLGFAMDVSRMRNVACYMSHSSSPNVLVQCVLYDHNNLMFPHLMLFA
LENIPPMRELSIDYGVADEWTGKLSICN
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgggttctcttgtacccttccaagacctcaatctttccccagaacctccccaaaccatc
agcgtcgatacccccccgtccgtgaccagcaccagcaccatcactttcttaacacccaaa
attgaacccaagcaagaacctttcgacgaaccagcaccaactcagaccaactacaggcaa
ataaacaccctcttttctccttccagttctgcccctgagttcccttctaatctcgaatct
acccctctgtctaacatttcctcttccaccgatgaccaaaacgccctttactccgaatac
ttccgaatctccgaactattccgctcggctttcgccaaaagattacaaaaatacggtgac
atcgacgtcctcgacccagattcccgggccatcgtgcccttgcccgaagaacaacgcgaa
ccaacctccgaaacctccccaattaacacctccaaccctgaccgagctctctccgtcgtc
ggttcacgtcgcagggccggaagatccaacgagctggttcgggtaactaatttgggaatc
gaagacgagaggcatttccgggacgttgtgcgaagaacccgaatgatgtacgattccctc
cgcattttggccattttggaggaagaaaagaggaagggaccggggcacgggagacgggca
cgtggcgatttgagagcagccgcgttgatgagggagcgagggctgtggttaaaccgtgat
aagagaatagtgggttcaatcccaggtattgaaattggtgacttgttctttttcagaatg
gagctttgtgtgatgggcttacatggacaagctcaagccgggattgattacttgcctgcg
agccagagctcgaatggggagccaattgccaccagcattattgtttcaggtggatacgag
gatgatcaagatgctggggacttgataatttacactggtcatggtggacaggataagctt
tcacggcaatgtatgcatcagaagcttgaaggagggaatttggcactagaaaggagtatg
cattatggaattgaggtaagggtgattagagggattaaatatgagaatagtgtttccagt
aaagtttatgtttatgatggtttatataagattcttgattgttggttcgatgtggggaag
tcaggtttcggggtttataagtataggttgttgagaattgatgggcaacccgagatgggt
agttcgattatgaggtttgctgagagtcttaggactaggcctttgtctgctaggccgatg
gggtatttgagtcttgatatttcaatgaaaaaagagaaagttccggtttttctatataac
gatattgatagtgatcatgatcctatgtattatgattatcttgtgaagactgtgtttcct
ccatatgcatttggtcaggggagtaatcgtactggatgtgagtgtgtttcggggtgtacg
gaggggtgcttttgtgctatgaagaacgggggtgattttggttatgatcataatggtctt
ctcttgagagggaaaccagtgatatttgaatgtgggaatttctgtcaatgccctccaact
tgtcggaaccgtgtttcacaacatgggttgagaaataggttggaaatatttaggtcaagg
gaaaccggttggggagtcagatccttggacttgatacaagctggtgcttttatatgtgaa
tatgcaggggtggttctcacaagggagcaagcgcaagttttcactatgaatggcgatacg
ttgatttatcccaatcggttctctgaacgatgggcagaatggggggatttatctcagata
tttgcagaatatgtgcgtccatcatatccctcaattccacctttaggttttgcaatggat
gtatcaaggatgaggaatgttgcttgttatatgagccatagttccagtcccaatgtactg
gtgcagtgtgtgttgtatgatcataataacttgatgttcccccaccttatgctttttgca
ctggagaatatccctcctatgagggagcttagcattgactatggtgtggctgatgaatgg
actgggaagctctctatttgtaactaa

DBGET integrated database retrieval system