KEGG   Theobroma cacao (cacao): 18603880Help
Entry
18603880          CDS       T02994                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00010  Glycolysis / Gluconeogenesis
tcc00053  Ascorbate and aldarate metabolism
tcc00071  Fatty acid degradation
tcc00280  Valine, leucine and isoleucine degradation
tcc00310  Lysine degradation
tcc00330  Arginine and proline metabolism
tcc00340  Histidine metabolism
tcc00380  Tryptophan metabolism
tcc00410  beta-Alanine metabolism
tcc00561  Glycerolipid metabolism
tcc00620  Pyruvate metabolism
tcc00903  Limonene and pinene degradation
tcc01100  Metabolic pathways
tcc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18603880
   00053 Ascorbate and aldarate metabolism
    18603880
   00620 Pyruvate metabolism
    18603880
  09103 Lipid metabolism
   00071 Fatty acid degradation
    18603880
   00561 Glycerolipid metabolism
    18603880
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    18603880
   00310 Lysine degradation
    18603880
   00330 Arginine and proline metabolism
    18603880
   00340 Histidine metabolism
    18603880
   00380 Tryptophan metabolism
    18603880
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    18603880
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    18603880
Enzymes [BR:tcc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     18603880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1350 AAA_25
Motif
Other DBs
NCBI-GeneID: 18603880
NCBI-ProteinID: XP_017973617
LinkDB All DBs
Position
3
AA seq 540 aa AA seqDB search
MAARRISSLLTRSLSASSSASASLLSSLGRNSSRNGSIKRLSTSTALEELIVPPVQIAYT
QNLIDGKFVDAASGKTFPTYDPRTGEVIAHVAEGDAEDVNRAVAAARKAFDEGPWPKMTP
YERSRILLRFADLVEKHSDELAALETWNNGKLHEQAAKAELPLLIRLFHYYAGWADKIHG
LTVPADGNHHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTAEQTPLTA
LYVAKLFHEAGLPPGVLNVVSGFGPTAGAALASHMDVDKIAFTGSTDTGKVVLELAAKSN
LKPVTLELGGKSPFIVCEDADIDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEK
AKARALRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGIESNATLECGGDRLGKKGYFI
QPTVFSNVTDDMLIAKDEIFGPVQSILKFKDLDEVIRRANATRYGLAAGVFTKNIDTANT
LTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcgcagaatctcttcgttgcttactcgttcactctctgcttcttcttctgcc
tctgcttctctgctttcatctctagggagaaacagtagcaggaatggaagtatcaagagg
ttaagcacttctacagcgctagaggaactgattgttccaccggttcaaattgcctacact
cagaatttaattgatgggaaatttgtggatgcggcatcagggaaaacattccccacctat
gaccctcgtactggagaagtgattgcacatgtcgctgaaggtgatgctgaagatgttaac
cgtgcagttgctgctgctcgcaaggcctttgacgagggaccatggccaaagatgactccc
tatgaacggtcacgaatattgttgcgctttgctgatttggttgagaaacatagtgatgag
ctcgcagctttagagacatggaataacggaaagcttcatgagcaggctgctaaagctgaa
ttgccattgctgatacgcctttttcactactatgctggttgggcggataagatccatggg
ttaactgttccagctgatggaaatcaccatgttcaaacattgcatgaaccaattggtgtt
gcaggacagataattccatggaactttcctcttctcatgtttgcttggaaagttgggcct
gcattagcctgtggcaatactatagtcttaaagactgctgagcaaactcctttgactgct
ctctatgtggctaagctgttccatgaggctggtctacctccaggtgttctgaatgtagtt
tctggctttggtcctacagctggtgcagctcttgccagtcacatggatgtagacaagatt
gcattcactggatcaaccgatacaggtaaggttgtgcttgaattggctgcaaaaagcaat
cttaagccagtaacattggagcttggagggaaatcacctttcatagtatgtgaagatgct
gatattgatcacgctgtggagcttgcacattttgctttgttctttaatcaggggcaatgt
tgctgtgctgggtctcgcacttttgtccacgaacgtgtgtatgatgagttcctagagaaa
gcaaaggcacgtgcattgagacgtgttgttggtgatcctttcaagaagggtgttgagcaa
ggtcctcagattgactcagagcagtttgagaaagtcctaagatacataagatctggcatt
gaaagcaatgcaacccttgaatgtggaggtgacagacttggcaaaaaaggctacttcatc
cagccaactgttttctcaaatgttacggatgatatgttgatagcaaaggatgaaatcttt
ggtccagtgcaatctatcttaaagttcaaagatctcgatgaagtaattcgaagggcaaat
gcaacccgatatggtttagcagctggagttttcaccaaaaacatagacacggccaacacc
ttgacacgggcattgagggctgggactgtatgggttaactgctttgatgtctttgatgct
gcaattccttttggtgggtacaagatgagtggcattggcagggaaaaaggaatctacagc
ctccataactatttgcaggtgaaggcagttgttacacctttgaagaatccagcatggttg
taa

DBGET integrated database retrieval system