KEGG   Theobroma cacao (cacao): 18609957Help
Entry
18609957          CDS       T02994                                 

Definition
(RefSeq) glutamate decarboxylase 4
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00250  Alanine, aspartate and glutamate metabolism
tcc00410  beta-Alanine metabolism
tcc00430  Taurine and hypotaurine metabolism
tcc00650  Butanoate metabolism
tcc01100  Metabolic pathways
tcc01110  Biosynthesis of secondary metabolites
Module
tcc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    18609957
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    18609957
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    18609957
   00430 Taurine and hypotaurine metabolism
    18609957
Enzymes [BR:tcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     18609957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 18609957
NCBI-ProteinID: XP_007045397
LinkDB All DBs
Position
2
AA seq 498 aa AA seqDB search
MVLSKTASESDVSIHSTFASRYVRASLPRFKMPENSVPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMDAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLQDSEAAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPAKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLIEKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSREDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYRNVMENCHENAMVLKEGLEK
TGRFNIVSKDHGVPLVAFSLKDNKRHDEFEISDMLRRFGWIVPAYTMPADAQHITVLRVV
IREDFSRTLAERLVLDIKKVLHELDTLPAKVNAKLAMAGEENGNNGTVKKSAIETQREIT
AYWMKYVSERKTNKNKIC
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggtgctatctaagacggcttctgagtctgatgtttcaattcactcgacgttcgcctct
cgctatgtccgagcctcacttcccaggttcaagatgccagagaactcggtaccaaaagaa
gctgcatatcagatcattaacgatgagctgatgcttgatgggaacccaaggttgaacctt
gcctcttttgttactacctggatggagcctgaatgtgataagcttatcatggatgccatt
aacaagaactatgttgacatggatgagtaccctgtcactaccgagcttcagaaccgttgt
gtgaacatgatagcacatctgttcaatgcaccgcttcaagactccgaggctgcagttgga
gtgggaacagttgggtcatctgaggcaatcatgttggctggccttgccttcaagagaaag
tggcagaacaagcgtaaggctgaaggcaaaccttatgacaaacccaacattgtcaccgga
gccaatgttcaagtgtgctgggagaaatttgcgaggtactttgaggtggagttgaaggaa
gtgaagctgagggaaggctactatgtgatggaccccgccaaagctgtggaaatggtagat
gaaaacaccatctgcgttgctgctatcttgggttccaccctcaatggagaatttgaagat
gtcaagcttctaaatgatctcttgatagaaaagaacaaggaaactggatgggatacacca
attcatgttgatgcagctagtggtggatttattgcgccatttttgtacccagagcttgaa
tgggacttcaggcttccccttgtgaagagcattaatgttagtggccacaaatatggtctt
gtctatgctggaattggatgggttatctggaggagcagggaagacttgcctgaagaactt
attttccacattaactaccttggagcagatcaacccactttcactctcaatttttccaaa
ggttctagccaagtcattgcccagtattaccaacttatccgtttgggttatgagggatac
agaaatgtgatggaaaactgtcatgaaaacgcaatggtcctgaaagaaggattggagaaa
acagggcggtttaacattgtgtcaaaggaccatggggttcccctggtggccttttctctc
aaggacaacaagcgccacgatgaattcgagatatctgacatgttgcgccggtttggttgg
atcgtgcctgcctacaccatgccagcagatgctcagcacatcactgtgctccgtgttgtc
atcagggaagacttctcccgcaccttagccgagcgtctcgtgcttgacatcaaaaaggtg
ctccatgagctggataccctccctgcaaaggtcaatgccaaactggctatggctggcgaa
gagaatggcaacaatggcactgtcaagaagagtgctattgagacccagagggaaatcact
gcttactggatgaaatatgtcagcgagaggaaaactaacaaaaacaagatatgttag

DBGET integrated database retrieval system