KEGG   Theobroma cacao (cacao): 18610503Help
Entry
18610503          CDS       T02994                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00010  Glycolysis / Gluconeogenesis
tcc00020  Citrate cycle (TCA cycle)
tcc00620  Pyruvate metabolism
tcc01100  Metabolic pathways
tcc01110  Biosynthesis of secondary metabolites
tcc01200  Carbon metabolism
Module
tcc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18610503
   00020 Citrate cycle (TCA cycle)
    18610503
   00620 Pyruvate metabolism
    18610503
Enzymes [BR:tcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     18610503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 18610503
NCBI-ProteinID: XP_017970883
UniProt: A0A061ECF5
LinkDB All DBs
Position
2
AA seq 484 aa AA seqDB search
MASPFLSNTTISFSSSLSSSHLPRLLPSISFSPIRFKSNPRRILIVRSKIREIFMPALSS
TMTEGKIVSWVKSEGDKLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGETAPVGAA
IGILAETEDEIAEAKAKAASKSGASTPSAPPPSPAPAATSTLAPPKPAPAPAPAPVAEGP
RKTVATPHAKKLAKQHKVDIESVVGTGPYGRITPADIEAAAGIAPSKTNVGPAVVVETTP
AAPPKATAAAAAPSSLPPPVPGSTVVPFTTMQAAVSKNMVESLSVPTFRVGYPVTTDALD
ALYAKVKPKGVTMTALLAKAAAMALAQHPVVNASCKDGKSFTYNSNINIAVAVAINGGLI
TPVLQDADKLDLYLLSQKWKELVEKARAKQLQPQEYNSGTFTLSNLGMFGVDRFDAILPP
GQGAIMAVGASKPTVVADADGFFSVKNKMLVNVTADHRIVYGADLAAFLQTFSKIVENPE
SLTL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcctttcctctccaacaccaccatctctttctcttcttccctctcttcctcc
catcttcctcgtcttctcccatccatttctttctccccgattcgtttcaaatcaaaccca
agacgaatcctgatcgtccgatccaagatcagggagattttcatgcccgcactcagttcc
accatgactgagggcaagatcgtctcctgggttaaatccgaaggcgataagctctccaag
ggagaaagcgtcgtcgttgtcgaatccgacaaggccgacatggatgtcgagactttctat
gacggcattctcgctgccatcgttgttggggaaggcgaaactgcccctgttggcgccgcc
attggtatccttgctgagactgaagatgaaattgccgaggctaaagccaaagctgcctcg
aaatcaggtgcttcaaccccatctgctcctcctccttctccagctccggctgctacttca
actctagctcccccgaagccagcgccggctcccgcgcctgcgccagttgcggagggaccg
aggaagaccgttgcgacacctcacgcaaagaagttagcgaagcagcacaaggtggatatt
gaatccgtggtgggaacagggccgtatggtaggattacccctgcggatatcgaggcagcc
gccgggatcgcgccttcgaagacaaatgtgggacctgcagtggtcgttgaaactacgccg
gctgctccaccgaaagctacagctgctgctgccgccccttctagcctgcctcctccagtt
ccggggtctacggtagtgccatttacgacaatgcaggctgccgtttcgaagaacatggtg
gagagtctttcagtgcccacatttcgagtggggtatccggtgactacagatgcgcttgat
gccttgtatgcgaaggtgaagcctaagggtgtgacaatgactgctctgttagcgaaagct
gctgcaatggcacttgcgcagcaccctgttgtgaatgcaagttgcaaagatggcaagagt
tttacttacaatagtaacatcaacatagcagtagctgtggctatcaatggtggcttgatt
acccctgttcttcaagatgcagataagttggatttgtatctattgtctcaaaaatggaaa
gagctggtggaaaaagcccgggcaaagcagcttcagccccaagagtataattcagggaca
ttcactctgtccaatctgggcatgtttggagtggacaggtttgatgccattcttccccca
ggacagggagctatcatggctgttggagcatcaaagccaactgttgtagctgatgctgat
ggattcttcagtgtgaaaaacaaaatgctggtgaatgtaactgctgatcaccgtattgtc
tatggtgctgatttggctgccttccttcagaccttctcaaagattgttgagaacccagaa
agcctgactttgtag

DBGET integrated database retrieval system