KEGG   Theobroma cacao (cacao): 18610944Help
Entry
18610944          CDS       T02994                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00020  Citrate cycle (TCA cycle)
tcc00190  Oxidative phosphorylation
tcc01100  Metabolic pathways
tcc01110  Biosynthesis of secondary metabolites
tcc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    18610944
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    18610944
Enzymes [BR:tcc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     18610944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3 GIDA DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 18610944
NCBI-ProteinID: XP_007046957
UniProt: A0A061DFR8
LinkDB All DBs
Position
1
AA seq 631 aa AA seqDB search
MWRCVSRSLRVPYSKRSVSYDSLRSHISKFLDNESVRSPYTIVDHTYDAVVVGAGGAGLR
AAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGD
QDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADR
TGHALLHSLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFRAVSTIL
ATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGE
GGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPE
VLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTVRGSNPDSVVP
GLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIHRPGEKLKPLEKDASEKTI
AWLDKIRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDEAWESFHDVKLKD
RSLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYW
ENEKVRLDYRPVHMNTLDDEIESFPPKARVY
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtttctcgtagccttcgagttccatactcgaagagatcggtctcatat
gactctcttagatctcacatttccaaattcctcgacaacgaatctgtacgatccccttat
accatagtggatcatacatatgatgcggtggtggttggtgccggtggtgcgggtctaaga
gcagccataggtctttcagagcatggattcaatactgcttgcattaccaagcttttccca
acacgttcacatactgttgcggctcagggtggtataaatgctgctttggggaatatgact
gaagatgactggcgatggcacatgtatgacacagttaaaggaagtgattggttaggtgat
caggatgctattcaatatatgtgcagggaggcaccaaaagctgttattgaacttgagaat
tatgggttgcctttttctcgaacagaagatgggaaaatatatcagcgtgcctttggcggt
caaagccttgactttggaaaaggtggacaggcttatcgttgtgcatgtgctgctgataga
accgggcatgctctattgcactctctctatggccaagctatgaaacataatacccaattc
tttgttgaatattttgctttggatctgttgatgaatagtgatgggagctgccagggagtg
atagctttgaacatggaggatggaacgctacatagatttcgtgctgtttcgacaattctg
gctactgggggatatggtagagcctacttttctgcaacctcggctcacacatgcactggt
gatggcaatgctatggttgctcgtgctgggcttcccctccaggatttggagtttgtgcaa
tttcacccaacgggaatctatggggctgggtgcctcatcactgaagggtctcgtggtgaa
ggtggtattcttagaaatagtgaaggtgaacgctttatggaacggtatgcccctacggcc
aaggatcttgcttcaagggatgttgtttcaagatctatgaccatggaaatcagggaaggt
cgtggtgtaggacctttgaaggatcatatctatctccacttgaatcacttacccccagag
gtgctcaaggagaggcttccaggtatctctgagacagctgccatttttgctggtgtggat
gttacaaaggagcccatccctgtcttgcctactgtacattataatatgggtggaattccc
acaaatcaccatggagaggttgttactgtcagaggcagcaatcctgattctgtggttcct
ggactaatggctgctggagaggcagcctgtgcatctgttcatggtgccaatcggttgggt
gcaaactcccttcttgatattgttgtctttggtcgggcttgtgcaaatagagttgcagag
atccatagaccaggggagaagctgaaacctttggagaaggatgccagtgagaaaacaatt
gcatggctggacaaaataagaaactcaaatggttctcttccaacttcaaaaattcgattg
aatatgcaacgagtaatgcaaaacaatgccgctgttttccgcacacaggaaacattagaa
gaaggttgtcagttaattgatgaggcatgggaaagtttccatgatgttaagttgaaggat
cgaagtctaatatggaactctgatttgatagagactatcgagctggaaaatcttttgata
aatgcctgtatcactatgcattctgctgaagctaggaaagagagcagaggtgcacatgcc
cgtgaagattttacgaaaagagatgatgagaactggatgaaacacacattgggctattgg
gagaatgagaaggttcgactggattaccggccagttcacatgaacacattagatgatgag
attgagtcattcccacctaaagcccgtgtgtattaa

DBGET integrated database retrieval system