KEGG   Theobroma cacao (cacao): 18611191Help
Entry
18611191          CDS       T02994                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00562  Inositol phosphate metabolism
tcc01100  Metabolic pathways
tcc04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18611191
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    18611191
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tcc01009]
    18611191
Enzymes [BR:tcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     18611191
    3.1.3.48  protein-tyrosine-phosphatase
     18611191
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     18611191
Protein phosphatases and associated proteins [BR:tcc01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    18611191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc PTEN_C2 Y_phosphatase Y_phosphatase3 PTPlike_phytase CDKN3
Motif
Other DBs
NCBI-GeneID: 18611191
NCBI-ProteinID: XP_017974987
LinkDB All DBs
Position
1
AA seq 650 aa AA seqDB search
MNSESADSSSQPLAKASDGETPAEATDVKPPANTSDAKHQAKANEVEPPARAVDVEPPKA
SDNPPTVTAKTNSSYDSPPSVLSSTAISSWARNLKFPQPVAPSQGSQAGNAGTSAFARFT
SGLGLRLQSMSLPPDDSAEHTSTATQAVLESFKKGIVDSSRSAVKAVQVKARHIVSQNKR
RYQEGEFDLDMTYITENIIAMGFPAGDLSSGLFGFFEGFYRNHMEEVIKFFETHHKGRYK
VYNLCSERLYDASLFQGKVASFPFDDHNCPQLQLIKSFCQSAYSWLKEDIENVVVVHCKA
GMGRTGLMICSLLLFLKFFPTAEEAIDYFNQKRCIDGKALVLPSQIRYVKYFECILRHFN
GENQPGHRCMLRGFRLHKCPYWIRPSITISNHNGTLFSTRKHPKTKDLMPEDFWIKAPKK
GIVVFALPGQPGLTELVGDFKIQFHDRQGDFYCWLNTTMIENRTILDTSDLDGFDKITVP
YPGFKVELVMVDYDGIPQSNSNTNSVNEETQGNSSYTKDGVTARSKHSKVSGNEDNGDVF
SDSDGEESGASRSRQTQAAGAGPAVSSHLTNPAAEQIGTSTHGTHQLSVKNQERALSNAS
KDVSINGVGKPCSGLEIPNLDSMGASDIKVIAADASVFSFGDEEEDYESE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgaactcagagtctgcggattcctcatctcaacctctcgctaaagcttctgatggtgaa
actcctgctgaagccactgatgttaaaccgccagcgaacactagtgatgccaaacatcaa
gcaaaagctaatgaggttgaacctcctgccagagctgttgatgttgaacctccaaaggcc
agtgataatccacctactgtcactgcaaaaactaattcctcgtatgattccccaccatct
gtgttatcctccactgccatatcttcttgggcaagaaatttgaaatttccacagcctgta
gcaccgtcacaaggctctcaagctggaaatgctgggacttcagcttttgcgcgcttcacc
agtgggcttggattgcggttgcaatcaatgagtctaccaccggatgatagtgcagagcat
acctctacagcgacacaagctgttcttgaatcattcaaaaagggtatagttgattcatct
cggagtgcagtgaaggcagtgcaggtcaaggcacgccatattgtctcacaaaacaaacgg
agataccaggagggagagtttgatttggatatgacttatatcactgagaatataattgct
atggggtttcctgctggtgatctaagctcagggctttttggattctttgagggcttctat
cgaaatcacatggaagaagtaatcaagttttttgaaactcatcacaagggaagatataaa
gtgtacaatttgtgttcagagaggttgtatgatgcatcactatttcaggggaaggttgca
agtttcccatttgatgaccacaattgccctcaacttcaactcataaaatccttttgtcaa
agtgcatactcatggctgaaggaggacatagaaaatgtggtggttgttcattgtaaagct
ggtatgggaaggacaggattaatgatttgcagtcttcttttattccttaagttctttccg
acagctgaagaggccatcgactacttcaaccagaaaagatgcatagacgggaaagctctg
gttctcccaagtcagattagatatgtcaaatactttgagtgtatcctaagacacttcaat
ggagaaaatcagcctggacataggtgcatgcttagggggttccggcttcataagtgtccc
tactggattaggccctctattactatctccaatcacaatggaactttgttctctacaaga
aagcatccaaaaacgaaggatttaatgccagaagatttctggattaaggcacctaagaaa
gggatagtggtttttgctctgcctgggcagcctggtctcacagaattggtgggtgacttc
aaaatccaatttcatgaccgtcaaggagatttctactgttggttaaatacaacaatgata
gagaacagaacaatactggacacctctgatcttgacggttttgacaagataactgtgcct
taccctggattcaaggttgaactggtaatggtagactatgacggtataccacagtcaaat
tctaatactaattctgtcaacgaagaaactcagggtaactccagttacaccaaggatgga
gtcacggcccgttcaaaacatagcaaagtttctggaaatgaagacaatggtgatgtattc
tcagacagcgatggggaggaatcaggggcttcaaggagtaggcagactcaagctgctgga
gctggacctgcagtctccagccatctaactaaccctgcagctgagcaaatagggacgtcc
acgcatggaactcatcaactatcagtcaaaaatcaagagcgagcgttgagcaatgcttcc
aaagacgtaagcattaatggagttggcaaaccttgctcaggacttgagatccccaatctg
gactccatgggagcaagtgatatcaaggtgattgctgctgatgcatcagtcttcagtttt
ggggatgaagaagaagattatgaaagcgaatga

DBGET integrated database retrieval system