KEGG   Theobroma cacao (cacao): 18612624Help
Entry
18612624          CDS       T02994                                 

Definition
(RefSeq) linoleate 9S-lipoxygenase 1
  KO
K00454  lipoxygenase [EC:1.13.11.12]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00591  Linoleic acid metabolism
tcc00592  alpha-Linolenic acid metabolism
tcc01100  Metabolic pathways
tcc01110  Biosynthesis of secondary metabolites
Module
tcc_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    18612624
   00592 alpha-Linolenic acid metabolism
    18612624
Enzymes [BR:tcc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.12  linoleate 13S-lipoxygenase
     18612624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipoxygenase PLAT LepA_C
Motif
Other DBs
NCBI-GeneID: 18612624
NCBI-ProteinID: XP_017974109
LinkDB All DBs
Position
1
AA seq 955 aa AA seqDB search
MAETTCCGLTTCCHRPHPENDIIEGTFEIDHSPRICLLPTLRSVAIQIYSADVVDPYTRS
GLESKKAYLQKWKINLNPSIIKYKLNFEVVRGFGSPGAFVVENRGRHEFFLKSATFKYKS
PAPDREDFFFHCASWVYPLDKTGVKRIFFINRLYLPEKTPPGLVVLRKKELKKLRGRGLK
DERHPWDRIYDYQCYNDLGDPDNSPEYARPILGGSKEYPYPRRLRTNRPPTQHDHLTESR
PVGCFRTFVPPDERLSQKKQEQLRNNFVDALVRFLTPKSDQPPQLHQECPTMVQKILHFF
VPKSAFSTADFSMIQSIVDFVLRKPKSPSHRDTQSVDSIDDIVAIFSDKQVKKMDERVKQ
KLKKLVPAEIFNQVVDATTKRDVLSSQPPSIMAEDQYDWLLDREFGRQMLAGTNPVRIQS
LEKFSPREGWLPKNLDLIEKAKSEAEAYFVLDHDYLRPFLSVINAKGVCAYATRTILKPS
GWDDRLEPIAIQLRLPDSEMDMVLEPDELEWDLAKAHVAANDAAHHQLVSHWLHTHAVIE
PFIIATRRQLSVMHPIHWLLDPHFKDTLHINALARGIFLNAGGILERILFTGEFSVRLSS
HFYKQWRFDEQALPKDLKKRGMAVDAKESVRDENVSEIKEKPAEKEPENIGEEDLAKKTE
NVVERDEGLAEIDENVVERDEGVAETDENVVELDENPAAPDEKVTFPAGMKFVLDDYPYA
KDGIEIWDAIETWVKAYCQIFYENDDSVRDDEEIRDWWEEIRRVGHVDQQQGWYDLTTRE
NLVRALTTLIWITSGMHAAVNFGQYAYAGWPPNRPMLLRKFIPKEGTKEYEDMQKDPEKF
FVKMLPEKFEMEFAIAVMDLLSRHTSDEVYLGQRPTDNMWKENKKVNEKFEEFGERLRKI
EGNILDRNKRYNLHNRWGYAKIPYKLLYPDTSKTEGPSEHKEDICGRGIPNSISI
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaactacttgctgtggactgacaacatgttgccatcgccctcaccctgaaaac
gacattatcgagggaacttttgagattgatcactcccctcggatttgtctccttcccact
ctacgatccgttgctattcagatttacagcgccgatgtagtcgatccatacactaggagc
gggttagaaagtaagaaggcatatctacagaagtggaaaatcaacctgaatccgagtata
atcaaatacaaactgaactttgaggtggtgcgcgggttcggctctcccggggcttttgtt
gtagaaaatagaggcaggcatgaattcttcctcaaatccgccactttcaagtacaaaagt
cctgctcctgacagggaggacttctttttccactgtgcttcctgggtgtacccacttgac
aagaccggagttaaacggattttcttcataaaccgattgtatcttccagagaaaacacct
cccggtttagttgtactgagaaaaaaagaacttaagaaactgagaggacgagggttgaaa
gatgagaggcatccatgggatagaatatacgactatcaatgctacaatgatcttggagat
cctgacaatagcccagagtatgctaggcctattttggggggttctaaggagtatccatat
ccacgcaggttaagaacaaaccgccctcctacccagcatgaccatttaaccgagtctcgg
ccggtaggatgctttcgaacttttgttccacctgatgagcgtttgagccagaagaaacaa
gaacaactcagaaacaacttcgtcgatgctcttgtgcgatttcttacccccaagtcagac
caaccaccccagttgcatcaagaatgtcccacaatggttcagaaaatcctacatttcttt
gttcccaagtcagcattttcaacagctgattttagtatgattcagtctattgttgatttc
gttctaaggaagccaaaatcaccatcccatcgagatacccaaagtgtagactcaatcgat
gacatagtcgccattttctcagacaaacaagtaaaaaaaatggatgagcgagtcaagcag
aagctgaaaaagttggtaccagctgaaatctttaaccaagttgttgatgctacgaccaaa
agagacgtcctcagctcacaacctccttcaattatggcagaggaccagtacgattggctt
cttgacagagagtttggacgccaaatgcttgcaggaacaaatccagtacgaatccagtcc
ttagagaaattctcacctcgagaaggttggcttccgaagaacctggaccttatagaaaag
gcaaagagtgaagctgaggcatatttcgtcttggatcacgactacctccggccgtttcta
agcgtgataaatgcaaagggtgtttgtgcttatgcaactcgaacaatactaaagccctca
gggtgggatgatagattagaaccaatagcaatacagcttcgcttgcctgatagcgaaatg
gacatggtccttgagccagacgagcttgaatgggaccttgcaaaagctcacgttgcagcc
aatgacgcagctcaccaccaattagttagccattggttgcatactcatgcagtaattgaa
ccattcattattgccactagaagacagttgagcgtgatgcatccaattcattggctattg
gatcctcatttcaaagacacattgcatataaatgcattggctcgaggcatcttcctgaat
gcagggggaattctagagagaatactctttacaggtgaattttccgtgcggctgtcctct
cacttctataaacaatggagatttgatgagcaagcccttccaaaagatcttaagaaaaga
ggcatggcagtagatgcaaaagaaagtgtaagagatgagaatgtctcagaaataaaggag
aagccagcagaaaaggaaccagagaatataggtgaggaggatctggcaaagaaaaccgag
aatgtggtagagagagatgagggtctggcagaaatagacgagaatgtggtagaaagagac
gagggtgtggcagaaaccgacgagaatgtggtagaattggacgagaatccagcagctccg
gatgaaaaggtgacatttcccgctgggatgaagttcgttttagacgactatccctatgct
aaggatggaattgagatatgggatgccattgagacatgggtgaaagcatattgccaaatt
ttctatgaaaacgatgattctgtcagggatgatgaggaaatcagagattggtgggaggag
attagacgtgtgggccatgttgatcaacagcaagggtggtatgatcttacaactcgtgaa
aacctggtaagggctctaacaactctgatatggattacttcaggtatgcatgctgcggtg
aactttgggcaatatgcgtatgccggttggcctccgaatcgccccatgctattgaggaag
ttcattccaaaagaaggtacaaaagaatatgaggacatgcagaaggatcctgagaagttt
tttgtcaagatgctgcctgaaaagtttgaaatggagtttgctatagcagtaatggacctt
ctctcacgccatacatctgatgaggtatacttgggccaaaggccaacggacaacatgtgg
aaagagaataaaaaggtaaacgaaaagtttgaagagttcggagaaagacttagaaaaata
gagggaaatatactggacagaaataaaagatataacctgcacaacaggtggggttatgcc
aagattccctacaagcttctgtatcctgatacatccaaaaccgagggtccctccgagcat
aaggaggatatttgtggaaggggaatccctaacagcatatctatatag

DBGET integrated database retrieval system