KEGG   Thermococcus celer: A3L02_02725Help
Entry
A3L02_02725       CDS       T05076                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tce  Thermococcus celer
Pathway
tce00030  Pentose phosphate pathway
tce01100  Metabolic pathways
tce01120  Microbial metabolism in diverse environments
tce01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A3L02_02725
Enzymes [BR:tce01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     A3L02_02725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ASI98558
UniProt: A0A218P0U6
LinkDB All DBs
Position
complement(489947..491764)
Genome map
AA seq 605 aa AA seqDB search
MYGNWGRFLRVNLSTGEVKVEEYDEELAKKWLGSRGLAIYLLLKEMDPKVDPLSPENKLI
IAPGPLSGTSAPTGGRYNVVTKSPATGFITMSNSGGYFGAELKFAGWDAIVVEGKAEKPV
YIYVKDDDVEIRDASHIWGKLVSETEETIRKEIGSKRLRIASIGPAGENLVKFAAVMNDG
HRAAGRAGVGAVMGSKNLKAIAVEGSKTVPVADKQKFMLTVREKINKLRNDPVAGGGLPK
FGTAVLVNIINENGLYPTRNFQTGVYEHAYEQSGEAMAAKYLIRNQPCYACPIGCGRVNK
LPTVGVTEGPEYESTWALGANLGINDLASIIEANHMCDELGLDTISTGGTLATAMELYEK
GFIKDEELGDAPPFRWGNTEVLHYYIDKLARREGFGDKLAEGGYRLAESYGHPEYSMSVK
KLELPAYDPRGAEGHGLGYATNNRGGCHIKNYMISPEILGYPYKMDPHDVSDDKVKMLIL
FQDLSALIDAAGLCLFTTFGLGADDYRDMLNAALGWDLSTEDYLKIGERIWNAERIFNLK
AGLDPERDDSLPKRFLEEPMPEGPNKGHVVRLKEMLPRYYKLRGWTEDGRVPKEKAEELG
IGEFL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtatggcaactggggaaggtttctgcgcgtaaacctctccaccggagaggtgaaggtt
gaggagtacgacgaggagctggccaagaagtggctcgggagcagggggcttgcgatatat
ctcctcctcaaggagatggatccaaaggtcgacccgctgagcccggagaacaagctgata
atagccccgggcccgctgagcgggacgagcgctccaaccggaggtaggtataacgtcgtc
acgaagagcccagcaacgggtttcataacgatgtccaactcgggaggatatttcggagcg
gagctcaagttcgccggatgggacgccatcgtcgtggagggcaaggccgagaagcccgtc
tacatctacgtaaaggacgatgacgtcgagatcagggatgcgtcccacatctggggcaag
ctcgtgagcgagaccgaggagacgataagaaaggagatcggaagcaagaggctcaggata
gcctcgatcggtccggctggagagaacctcgttaagttcgctgcggtcatgaacgatgga
cacagggccgcaggcagggcgggcgtcggtgccgtgatgggaagcaagaacctgaaggcc
atagccgtcgagggaagcaagaccgtgccggtagcggacaagcagaagttcatgctaacg
gttagggagaagatcaacaagctgaggaacgacccggtcgcgggaggcggactcccgaag
ttcggtaccgcggttctcgtcaacataatcaacgaaaacggcctttacccaacgaggaac
ttccagacgggtgtctatgagcacgcctacgagcagagcggtgaggcgatggcggcgaag
tacctgatcaggaaccagccgtgttacgcgtgcccgattggctgtggcagggtcaacaag
cttccgaccgttggagtcaccgaggggccggaatacgagagcacctgggcccttggggcg
aacctcggtataaacgacctcgcgagcataatcgaggcaaaccacatgtgcgacgagctc
ggtctcgacaccatctcaaccggtggaaccctcgcaacggcgatggagctctacgagaag
gggttcataaaggacgaggagcttggggacgctccaccgttcaggtggggcaacacggag
gtcctccactactacatcgataagctcgcgaggagagagggatttggggataagctcgcc
gagggtggctaccgcctcgcggagagctacggacaccccgagtactccatgagcgtcaag
aagctcgagcttccggcttatgacccgcgcggtgctgaagggcacggcctcggttacgcg
accaacaaccgcggtggatgccacataaagaactacatgataagccccgagatcctcggc
tatccttacaagatggatccccatgatgtgagcgatgataaggtcaagatgctgatactc
ttccaggacctcagcgccctcatcgatgcggccggtctgtgcctcttcacgaccttcggc
ctgggagcagatgactaccgcgacatgctcaacgcggccctcggctgggacctctccaca
gaggactacctcaagataggcgagaggatatggaacgccgagcgcatcttcaacctcaag
gccggcctcgacccggagagggatgattcccttccaaagcgcttcctcgaggagcccatg
ccggagggcccgaacaagggtcacgtggtcaggctcaaggagatgctaccgcgctactac
aagctccgcggctggacggaggacggaagggttccgaaggagaaggccgaggaactcggc
atcggggagttcctctga

DBGET integrated database retrieval system