KEGG   Thermococcus chitonophagus: CHITON_0092Help
Entry
CHITON_0092       CDS       T04536                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, archaeal
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tch  Thermococcus chitonophagus
Pathway
tch00620  Pyruvate metabolism
tch00680  Methane metabolism
tch00720  Carbon fixation pathways in prokaryotes
tch01100  Metabolic pathways
tch01120  Microbial metabolism in diverse environments
tch01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CHITON_0092
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    CHITON_0092
   00680 Methane metabolism
    CHITON_0092
Enzymes [BR:tch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CHITON_0092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 DUF961 PEPcase
Motif
Other DBs
NCBI-ProteinID: CUX76871
UniProt: A0A160VTH5
LinkDB All DBs
Position
I:complement(77839..79248)
Genome map
AA seq 469 aa AA seqDB search
MIPRIMSTQHPDNYSIPFFSHSPVLGGEDEITEAFYAYSVLGADEQMWDFEGKEVDEFVV
KKLLERYPMFFRKNILGKDLRLTPRVPNPTVEKAEAKLLLETLQGITRAADYARLFYNDS
IAPIFEVILPMTTSSAELERVYSLYKRIVSISDELIHDVTVREWIGEFYPKEIRVIPLFE
TKSALLKSSRIVKEYLDGKDFEYQRVFFARSDPAMNYGLITAVTYVKKALYELSKLEEEL
SIPLYPIVGVGGPPFRGGMRPDNVDAVLREYPSVQTYTIQSSFKFDNPAREVVKAVDKIK
ATKRGKPIPVEIPDFLMEYEVEYQSQIKILAPHIRRMASKIPDRRRRKLHIGLFGYARKV
NGQALPRAIKFTASLYSIGLPPELLALNAISDKQLEKISEYYLNVYEDLEFAMQFFSYKV
AEEVGLKKLADRIREFKPDIHEEYVREAESVFKGEGDVMKLAQMRGFLG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtgataccgaggattatgagtactcaacacccagacaactattcaatacccttcttttcg
cactcaccagttttagggggagaggatgaaataacggaggcattctacgcttatagtgtt
ctcggcgccgatgagcagatgtgggactttgagggaaaggaagttgatgagttcgtggtt
aagaagttgctcgagaggtacccaatgttcttcagaaagaacatcctgggaaaggacttg
aggctaactcctagggttcctaacccaaccgttgaaaaggctgaggcaaagcttctcctt
gaaaccttacagggcatcacaagggctgccgactatgctaggctattctataatgattct
atagccccaatatttgaagtaatcctaccaatgacaacgagttcagctgaacttgagagg
gtttattccctgtacaagaggatagtgagtataagcgatgagttaatacatgatgtgact
gttagggaatggataggggaattttatcccaaagaaattagagtcattccgctctttgaa
accaaatctgcccttctaaagtcttcaaggatcgtaaaggagtatttggatggaaaggac
ttcgagtatcagagggtgttctttgcaaggagcgatcctgcaatgaactatggtctcata
acggctgtaacatacgtgaagaaagcattatatgagctctcgaagttagaagaggaactt
tcaattcccctttatccgatagttggtgttggagggccacccttcaggggaggaatgagg
cctgacaacgttgatgccgtgcttagagaatatccaagcgttcaaacttacacgattcag
agctcattcaaatttgataatcccgctagagaggtagttaaggccgttgataagataaaa
gccactaaaaggggaaaaccaattccagtagagataccagacttccttatggagtatgaa
gttgaatatcaaagtcagataaaaattctagctcctcacataagaagaatggcatcaaag
ataccagacagaaggaggaggaagcttcatattggcctctttggatatgctaggaaggtc
aacggacaagccctacccagggccattaagtttacggcttccctatattcaataggtctt
ccacccgagcttctagcattgaacgctattagtgataagcagcttgaaaagatctcagaa
tactatctcaatgtttacgaggatctcgagtttgcaatgcagttcttctcctacaaagtg
gctgaggaagtcgggttgaagaagttggctgatagaattagggagttcaaacctgatatc
catgaggagtacgtgagggaagctgagtcagtgttcaagggtgaaggtgatgtcatgaag
ttagctcaaatgaggggcttcctgggatga

DBGET integrated database retrieval system