KEGG   Tatumella citrea: A7K98_00255Help
Entry
A7K98_00255       CDS       T04873                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
tci  Tatumella citrea
Pathway
tci00564  Glycerophospholipid metabolism
tci01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tci00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A7K98_00255
Enzymes [BR:tci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A7K98_00255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_oxidored 3HCDH_N Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: ARU92363
UniProt: A0A1Y0LFT5
LinkDB All DBs
Position
complement(45871..47397)
Genome map
AA seq 508 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEARDFASATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHLAFPMRFRLPHRPHLRPAWMIRMGLFLYDHLGKRTSLPAS
KGLKFGSDSVLKPEITRGFEYSDCWVDDARMVILNAQAVTERGGEVKTRTRVTRAWRENG
LWVVEAENTDSGEKFRWQAKGLVNAAGPWVKEFFDHGLELKSPYGIRLIKGSHIVVPRVH
TEKQAYILQNEDHRIVFVIPWMDEFSIIGTTDVEYHGDPKEVAIDDNEIDYLLKVFNVHF
RHSLTRQDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVHDDQGKAPLLSVFGGKLTTYRK
LAEHAMEKLAKYYPGAGPAWTKNSVLPGGHFSGSREDFAAGLRRRYPFITDGMATHYART
YGSNTEKLLGNAQQLEDLGENFGHEFYEAELRYLVDHEWVRELDDAIWRRTKQGMWLTQE
QQARITEWLQAQHPVVPAPTKLHAVTEI
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatcttatcgtcatcggcggcggtatcaacggcgccggtattgcggca
gatgcagccggacgtggcctgtcggtattgatgctggaggccagggattttgcatctgct
acttcctctgccagttcgaaactgatccatggcggcttacgctatctggagcattatgaa
ttccggctggtcagtgaggcccttgccgagcgcgaagtgctactgaaaatggcacctcat
ctggcgtttcctatgcgcttccggctgcctcatcgcccgcatttacgcccggcctggatg
atccgaatgggtctgtttctgtatgatcatctgggtaaacgtaccagcctgccagccagt
aaagggctcaaatttggcagtgattcggttctgaaaccagaaattacccgcggttttgaa
tattcagactgctgggtagatgatgccagaatggttatcctgaatgcacaagccgtgacc
gaacgcggtggtgaagtgaaaacccgtacccgggtcacccgggcctggcgcgaaaacggc
ctttgggtggttgaagccgaaaatacagacagtggtgagaagtttcgttggcaggctaaa
ggtctggtgaatgctgccgggccgtgggtgaaagaattcttcgatcacgggctggagttg
aaatcaccttatggcattcgtctgatcaaaggcagccatattgtggttccccgggttcat
accgaaaagcaggcttatattctgcaaaacgaagatcaccggattgtgtttgttattccg
tggatggatgagttttcgattatcgggacgacggatgtcgaatatcatggcgatccaaaa
gaggttgccattgacgataacgaaattgattacctgctgaaggtatttaatgtgcatttc
cgccacagtctgactcgccaggatatcgtctggacttattccggtgtccgtccactgtgt
gacgatgaatctgactcacctcaggccgtcacccgtgactacacactggatgtgcatgat
gaccagggcaaagcaccattgttatcggtattcggtggcaagctgacaacttatcgtaag
ttagcagaacatgccatggagaaactggcaaaatactatcccggagcgggcccggcatgg
actaaaaactctgtactgcctggtggccatttttctggcagccgcgaagatttcgcagca
ggcttacgcagacgctatccatttattaccgatggtatggctacccactacgcccgtact
tatggcagcaatactgagaagttactgggtaatgcacagcagctggaagatttaggagag
aatttcggccatgaattttatgaagccgaactccgctatctggtagatcacgaatgggtc
cgtgagctggatgatgctatctggcgcaggaccaaacagggtatgtggctgactcaggaa
cagcaggctcgaatcaccgaatggttgcaggcccagcaccctgtggtaccggcaccgacg
aaactgcatgcagtgaccgaaatctga

DBGET integrated database retrieval system