KEGG   Tatumella citrea: A7K98_06345Help
Entry
A7K98_06345       CDS       T04873                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tci  Tatumella citrea
Pathway
tci00010  Glycolysis / Gluconeogenesis
tci00260  Glycine, serine and threonine metabolism
tci00680  Methane metabolism
tci01100  Metabolic pathways
tci01110  Biosynthesis of secondary metabolites
tci01120  Microbial metabolism in diverse environments
tci01130  Biosynthesis of antibiotics
tci01200  Carbon metabolism
tci01230  Biosynthesis of amino acids
Module
tci_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tci_M00002  Glycolysis, core module involving three-carbon compounds
tci_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A7K98_06345 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    A7K98_06345 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A7K98_06345 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tci04131]
    A7K98_06345 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tci04147]
    A7K98_06345 (gpmA)
Enzymes [BR:tci01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     A7K98_06345 (gpmA)
Membrane trafficking [BR:tci04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    A7K98_06345 (gpmA)
Exosome [BR:tci04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   A7K98_06345 (gpmA)
  Exosomal proteins of melanoma cells
   A7K98_06345 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ARU93432
UniProt: A0A1Y0LH99
LinkDB All DBs
Position
complement(1333489..1334241)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNQENRFTGWYDVDLSEKGRGEAKAAGKLLKDEGFSFDFAYTSVL
KRAIHTLWNVLDELDQVWLPVEKSWRLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELDRSDERFPGHDPRYASLTAEQLPTTESLALTIERVIPFWEQSILPRIKSGEKVI
IAAHGNSLRALIKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaccaagcttgttctggtacgtcacggcgaaagccagtggaatcaggaaaac
cgctttaccggctggtacgatgtggacctgtctgaaaagggccgcggagaagcaaaagcc
gcagggaagttactgaaagatgaaggtttcagcttcgactttgcttatacgtcggttctg
aagcgtgctatccatactctttggaatgtactggatgaacttgatcaggtctggctgccg
gttgagaaatcctggcgcctgaacgaacgccattacggcgcactgcaaggcctgaataaa
gcagaaaccgcagaaaaatacggtgatgagcaggtaaaacagtggcgtcgtggttttgca
gtaactccaccggaactggatcgtagtgatgagcgtttccccggccatgacccgcgttat
gcctctttaaccgctgaacaattgccaaccaccgaaagcctggcgctgaccattgagcgc
gttattccattctgggaacagtctattctgccacgcattaaaagcggtgagaaagtgatc
attgcggcgcatggtaactctctgcgggcattgatcaaatatctggacaacatgtcagaa
gatgaaattctggaactgaatattcctaccggggttccactggtatatgagtttgatgaa
aacttcaaaccactgaaacactattacctgggtaatgccgacgaaatcgcagctaaagct
gctgccgtcgcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system