KEGG   Tatumella citrea: A7K98_06980Help
Entry
A7K98_06980       CDS       T04873                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
tci  Tatumella citrea
Pathway
tci00061  Fatty acid biosynthesis
tci01100  Metabolic pathways
tci01212  Fatty acid metabolism
Module
tci_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:tci00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A7K98_06980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tci01004]
    A7K98_06980
Enzymes [BR:tci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     A7K98_06980
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     A7K98_06980
Lipid biosynthesis proteins [BR:tci01004]
 Fatty acid synthase
  Component type
   A7K98_06980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ARU93546
UniProt: A0A1Y0LIH1
LinkDB All DBs
Position
complement(1488144..1488662)
Genome map
AA seq 172 aa AA seqDB search
MVDKRDSYTKEDLAASGRGELFGENGPPLPAGNMLMMDRVVKMSETGGKYDKGFVEAELD
ITPDLWFFACHFVNDPVMPGCLGLDAMWQLVGFYLGWLGAEGKGRALGVGEVKFTGQVLP
TAKKVTYKIHFKRVINRKLVMGVADGEVFVDGQLIYNANDLKVGLFKDAAAF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaacgcgattcctatacaaaagaagaccttgctgcctccggacgcggagag
ctatttggcgagaatggcccgccattaccagcagggaacatgctgatgatggaccgtgtc
gtcaaaatgtccgaaacgggtggtaagtacgataaaggtttcgttgaagctgaattagat
atcactcctgatttatggttttttgcctgccatttcgtcaatgacccggttatgcctggt
tgtctgggcctggatgctatgtggcaactggttggtttttaccttggctggctgggtgcc
gaaggtaaaggacgtgcactgggtgtaggtgaagttaaattcaccggacaggtattaccg
acagcgaagaaagtcacttacaaaatccacttcaaacgcgttatcaatcgcaagttggta
atgggtgttgctgatggagaagttttcgttgatggtcagttgatctacaacgctaacgat
ctgaaagtgggtctgttcaaggacgctgcggcgttctaa

DBGET integrated database retrieval system