KEGG   Tatumella citrea: A7K98_13300Help
Entry
A7K98_13300       CDS       T04873                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
tci  Tatumella citrea
Brite
KEGG Orthology (KO) [BR:tci00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A7K98_13300
Enzymes [BR:tci01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A7K98_13300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like K_oxygenase DAO FAD_binding_3 Thi4 AlaDh_PNT_C FMO-like NAD_binding_8 Glutaredoxin OST_IS NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ARU94649
UniProt: A0A1Y0LKU2
LinkDB All DBs
Position
complement(2802998..2804569)
Genome map
AA seq 523 aa AA seqDB search
MLDTTLKNQLSIYLEKLTRPVELIATLDDSKASGEVRELLNEITGLSDKLTLTLDDSLAV
RKPSFMITQPGQNHGPRFAGSPLGHEFTSLVLALLQTGGHPSKESQELLSQVAGLDGELN
FETYYSLSCHNCPDVVQALNLMAILNPQVTHTAIDGGVFQNEIEQREIMGVPAVFLNGES
FAQGRLTLSEIVTKVDTGAGKKAAEALNQREPYDVLIVGSGPAGVAAAIYAARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGIKLAGALRQHVSDYQIDVIEAQTASQLLPALVPG
GLHSVATESGATLKARSVILATGARWRNMNVPGEEQYRTRGVTYCPHCDGPLFKGKRVAV
IGGGNSGAEAAIDLAGITEHVTLLEFAGELKADKVLQDKLHSLKNVDVIVNALTQEVTGD
GKQVTGLRYQDRQTSEQHDLAVSGIFVQIGLLPNTQWLSESITLNRFGEIEVDSKCETNQ
KGIFAAGDCTTVPYKQIIVASGEGAKASLSAFDYLIRTTPAEE
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctcgataccacattaaaaaaccaactcagtatttatcttgaaaaactgacccgtccg
gtagagttaatcgcgactctggatgacagtaaagcttccggtgaagtgcgggaattactg
aatgaaattaccggactgtccgacaagttaactctgacgctggatgacagcctggcagtt
cgtaaaccttcatttatgattactcagccaggccagaaccatggtccgcgttttgccgga
tcacccctgggacatgagtttacttctctggtgctggcattgctgcagactggcggtcat
ccgtcaaaagagagtcaggaattgttatctcaggttgccggactggacggtgaactgaac
tttgaaacttattattctctgtcctgccacaactgcccggatgtagtgcaggcactgaac
ctgatggcgattcttaaccctcaggtaacccatactgccattgatggtggcgtatttcag
aatgaaatcgaacaacgcgaaatcatgggcgttcctgcggtgttcctgaacggtgaaagt
tttgctcaggggcgtctgacactgagtgaaatcgtcactaaagtggataccggtgccggt
aaaaaagcggctgaagcacttaaccagcgtgagccttatgatgtgttgattgtcggcagt
ggccctgccggtgttgcggcggctatttatgcagcccgcaaaggcattcgcaccggatta
atgggtgaacgttttggtggacaggttctggatactgttgatatcgaaaactatatttcg
gtaccaaagaccgaaggcatcaaactggccggcgcattacgccagcacgtttctgactat
cagattgatgttatcgaggcccagactgccagccagttattacctgctctggtccctggt
ggattgcattcagtggccactgaatccggcgcgaccctcaaagcacgctcggtcatcctg
gcgaccggtgcccgctggcgcaatatgaatgtgccgggagaagaacaataccgtacccgt
ggtgtgacttactgcccacactgtgacggtccgttgttcaaaggaaaacgtgtggcagtg
attggcggaggaaattccggagccgaagctgcgattgatttggccggtattaccgaacat
gtcacattgctcgaattcgccggtgaactgaaagccgataaggtactgcaggataaactg
cacagcctgaaaaatgttgatgtcatcgtcaatgctctgacgcaggaagtgaccggtgat
ggtaaacaagtgacagggctgcgttatcaggaccgtcagaccagtgaacagcatgatctt
gccgtttcagggatcttcgtacagattggcttattgcctaacactcaatggctgagtgag
agcatcactctgaatcgcttcggtgaaatcgaagttgacagtaagtgtgaaaccaatcag
aaggggatttttgctgccggtgactgtaccaccgtgccatataagcaaattattgttgcc
agcggtgaaggagctaaagcttcactgagtgcttttgattacctgatcagaaccacgcct
gctgaagaataa

DBGET integrated database retrieval system